BLASTX nr result
ID: Cornus23_contig00020162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00020162 (414 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007225558.1| hypothetical protein PRUPE_ppa006120m2g, par... 56 9e-06 >ref|XP_007225558.1| hypothetical protein PRUPE_ppa006120m2g, partial [Prunus persica] gi|462422494|gb|EMJ26757.1| hypothetical protein PRUPE_ppa006120m2g, partial [Prunus persica] Length = 332 Score = 56.2 bits (134), Expect = 9e-06 Identities = 41/98 (41%), Positives = 54/98 (55%), Gaps = 5/98 (5%) Frame = -3 Query: 283 KNMQVASNARRLTRVLRPSHPPPILLQYSDHHHSFQTPHLQSPPTALQWRNHSTLWS--- 113 K MQV SN RRL+R L+ PI ++ SD S +++P T+ QWRN ST+ S Sbjct: 25 KAMQVVSNTRRLSRALKS----PIFIK-SDQFLSPDVRVVEAPLTSFQWRNLSTVSSRNS 79 Query: 112 --SGMIRDNSRHMLQLPTCSMMIHRALYSSETTTDEAG 5 SG+ R M Q C+MM RA +SSE +T E G Sbjct: 80 LFSGITRGYLLPMEQRTMCTMMTLRAPFSSEASTVEGG 117