BLASTX nr result
ID: Cornus23_contig00019880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00019880 (367 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001800301.1| hypothetical protein SNOG_10018 [Parastagono... 75 3e-11 ref|XP_003300851.1| hypothetical protein PTT_12212 [Pyrenophora ... 72 2e-10 ref|XP_001936166.1| arrestin domain containing protein [Pyrenoph... 72 2e-10 ref|XP_014553153.1| hypothetical protein COCVIDRAFT_29600 [Bipol... 70 5e-10 ref|XP_007683487.1| hypothetical protein COCMIDRAFT_1328 [Bipola... 70 5e-10 ref|XP_007710189.1| hypothetical protein COCCADRAFT_34990 [Bipol... 70 5e-10 ref|XP_014077309.1| hypothetical protein COCC4DRAFT_143153 [Bipo... 70 5e-10 ref|XP_007699573.1| hypothetical protein COCSADRAFT_89006 [Bipol... 70 5e-10 ref|XP_003840129.1| hypothetical protein LEMA_P109150.1 [Leptosp... 70 6e-10 ref|XP_008024960.1| hypothetical protein SETTUDRAFT_19851 [Setos... 67 4e-09 gb|KNG52480.1| arrestin domain-containing protein [Stemphylium l... 66 9e-09 ref|XP_007802631.1| hypothetical protein EPUS_05581 [Endocarpon ... 59 2e-06 gb|KPI38643.1| putative arrestin-related trafficking adapter C2D... 58 3e-06 ref|XP_008712860.1| hypothetical protein HMPREF1541_09966 [Cyphe... 58 3e-06 ref|XP_007785346.1| hypothetical protein W97_09295 [Coniosporium... 57 7e-06 >ref|XP_001800301.1| hypothetical protein SNOG_10018 [Parastagonospora nodorum SN15] gi|160707221|gb|EAT82353.2| hypothetical protein SNOG_10018 [Parastagonospora nodorum SN15] Length = 680 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+PE NDR RVEIPLTPGGRTNRSMDERRTWLPVG Sbjct: 644 DSDPERNDRARVEIPLTPGGRTNRSMDERRTWLPVG 679 >ref|XP_003300851.1| hypothetical protein PTT_12212 [Pyrenophora teres f. teres 0-1] gi|311324812|gb|EFQ91055.1| hypothetical protein PTT_12212 [Pyrenophora teres f. teres 0-1] Length = 804 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+PE NDR RVEIPLTPGGR NRSMDERRTWLPVG Sbjct: 768 DSDPERNDRMRVEIPLTPGGRANRSMDERRTWLPVG 803 >ref|XP_001936166.1| arrestin domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983265|gb|EDU48753.1| arrestin domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 807 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+PE NDR RVEIPLTPGGR NRSMDERRTWLPVG Sbjct: 771 DSDPERNDRMRVEIPLTPGGRANRSMDERRTWLPVG 806 >ref|XP_014553153.1| hypothetical protein COCVIDRAFT_29600 [Bipolaris victoriae FI3] gi|578486095|gb|EUN23577.1| hypothetical protein COCVIDRAFT_29600 [Bipolaris victoriae FI3] Length = 794 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+PE DR RVEIPLTPGGR NRSMDERRTWLPVG Sbjct: 758 DSDPERRDRARVEIPLTPGGRANRSMDERRTWLPVG 793 >ref|XP_007683487.1| hypothetical protein COCMIDRAFT_1328 [Bipolaris oryzae ATCC 44560] gi|576936420|gb|EUC49915.1| hypothetical protein COCMIDRAFT_1328 [Bipolaris oryzae ATCC 44560] Length = 794 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+PE DR RVEIPLTPGGR NRSMDERRTWLPVG Sbjct: 758 DSDPERRDRARVEIPLTPGGRANRSMDERRTWLPVG 793 >ref|XP_007710189.1| hypothetical protein COCCADRAFT_34990 [Bipolaris zeicola 26-R-13] gi|576921343|gb|EUC35485.1| hypothetical protein COCCADRAFT_34990 [Bipolaris zeicola 26-R-13] Length = 794 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+PE DR RVEIPLTPGGR NRSMDERRTWLPVG Sbjct: 758 DSDPERRDRARVEIPLTPGGRANRSMDERRTWLPVG 793 >ref|XP_014077309.1| hypothetical protein COCC4DRAFT_143153 [Bipolaris maydis ATCC 48331] gi|451995418|gb|EMD87886.1| hypothetical protein COCHEDRAFT_1216998 [Bipolaris maydis C5] gi|477586315|gb|ENI03400.1| hypothetical protein COCC4DRAFT_143153 [Bipolaris maydis ATCC 48331] Length = 830 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+PE DR RVEIPLTPGGR NRSMDERRTWLPVG Sbjct: 794 DSDPERRDRARVEIPLTPGGRANRSMDERRTWLPVG 829 >ref|XP_007699573.1| hypothetical protein COCSADRAFT_89006 [Bipolaris sorokiniana ND90Pr] gi|451851773|gb|EMD65071.1| hypothetical protein COCSADRAFT_89006 [Bipolaris sorokiniana ND90Pr] Length = 794 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+PE DR RVEIPLTPGGR NRSMDERRTWLPVG Sbjct: 758 DSDPERRDRARVEIPLTPGGRANRSMDERRTWLPVG 793 >ref|XP_003840129.1| hypothetical protein LEMA_P109150.1 [Leptosphaeria maculans JN3] gi|312216700|emb|CBX96650.1| hypothetical protein LEMA_P109150.1 [Leptosphaeria maculans JN3] Length = 794 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+ E NDRGRVEIPLTPGGRT RSMDERRTWLPVG Sbjct: 758 DSDLERNDRGRVEIPLTPGGRTARSMDERRTWLPVG 793 >ref|XP_008024960.1| hypothetical protein SETTUDRAFT_19851 [Setosphaeria turcica Et28A] gi|482810522|gb|EOA87328.1| hypothetical protein SETTUDRAFT_19851 [Setosphaeria turcica Et28A] Length = 794 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+ E +DR RVEIPLTPGGR NRSMDERRTWLPVG Sbjct: 758 DSDRERHDRARVEIPLTPGGRANRSMDERRTWLPVG 793 >gb|KNG52480.1| arrestin domain-containing protein [Stemphylium lycopersici] Length = 796 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 DS+ E NDR RVEIPLTPGGR RSMDERRTWLPVG Sbjct: 760 DSDHERNDRARVEIPLTPGGRAARSMDERRTWLPVG 795 >ref|XP_007802631.1| hypothetical protein EPUS_05581 [Endocarpon pusillum Z07020] gi|539435323|gb|ERF71709.1| hypothetical protein EPUS_05581 [Endocarpon pusillum Z07020] Length = 841 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 360 EPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 + E DRGRV+IPLTPGGR NRSMD RTWLP+G Sbjct: 803 DDEQEDRGRVDIPLTPGGRINRSMDASRTWLPLG 836 >gb|KPI38643.1| putative arrestin-related trafficking adapter C2D10.04 [Phialophora attae] Length = 706 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 D E E +DR R+++PLTPGGR NRSMD RTW+P+G Sbjct: 658 DEEEERSDRSRIDVPLTPGGRVNRSMDISRTWVPLG 693 >ref|XP_008712860.1| hypothetical protein HMPREF1541_09966 [Cyphellophora europaea CBS 101466] gi|568122497|gb|ETN45090.1| hypothetical protein HMPREF1541_09966 [Cyphellophora europaea CBS 101466] Length = 696 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -2 Query: 366 DSEPEHNDRGRVEIPLTPGGRTNRSMDERRTWLPVG 259 D E E +DR R+++PLTPGGR NRSMD RTW+P+G Sbjct: 651 DEEDERSDRSRIDVPLTPGGRVNRSMDISRTWVPLG 686 >ref|XP_007785346.1| hypothetical protein W97_09295 [Coniosporium apollinis CBS 100218] gi|494834411|gb|EON70029.1| hypothetical protein W97_09295 [Coniosporium apollinis CBS 100218] Length = 798 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -2 Query: 339 GRVEIPLTPGGRTNRSMDERRTWLPVG 259 GRVEIPLTPG R NRSMDERRTWLP+G Sbjct: 768 GRVEIPLTPGARVNRSMDERRTWLPIG 794