BLASTX nr result
ID: Cornus23_contig00019771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00019771 (376 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACQ63293.1| acyl acyl-carrier-protein thioesterase type B [Ca... 74 4e-11 gb|ACQ57190.1| acyl acyl-carrier-protein thioesterase type B [Ca... 73 9e-11 gb|ACQ57189.1| acyl acyl-carrier-protein thioesterase type B [Ca... 71 3e-10 gb|AAX51636.1| chloroplast palmitoyl/oleoyl specific acyl-acyl c... 70 5e-10 gb|AGC31683.1| chloroplast acyl-acylcarrier protein thioesterase... 69 1e-09 ref|XP_011078334.1| PREDICTED: palmitoyl-acyl carrier protein th... 69 1e-09 gb|AGC31686.1| chloroplast acyl-acylcarrier protein thioesterase... 67 4e-09 gb|AGC31685.1| chloroplast acyl-acylcarrier protein thioesterase... 66 9e-09 ref|XP_007013278.1| Fatty acyl-ACP thioesterases B isoform 2 [Th... 66 1e-08 ref|XP_007013277.1| Fatty acyl-ACP thioesterases B isoform 1 [Th... 66 1e-08 gb|ACQ57188.1| acyl acyl-carrier-protein thioesterase type B [Ca... 66 1e-08 gb|AAX51637.1| chloroplast stearoyl/oleoyl specific acyl-acyl ca... 65 3e-08 emb|CBI28125.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002284850.1| PREDICTED: palmitoyl-acyl carrier protein th... 64 3e-08 emb|CDP20806.1| unnamed protein product [Coffea canephora] 64 4e-08 gb|AIX97815.1| fatty acyl-ACP thioesterase B [Prunus sibirica] 63 1e-07 ref|XP_008386232.1| PREDICTED: palmitoyl-acyl carrier protein th... 63 1e-07 ref|XP_008242683.1| PREDICTED: palmitoyl-acyl carrier protein th... 63 1e-07 ref|XP_007202158.1| hypothetical protein PRUPE_ppa006328mg [Prun... 63 1e-07 ref|XP_012448973.1| PREDICTED: palmitoyl-acyl carrier protein th... 62 1e-07 >gb|ACQ63293.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 434 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -3 Query: 374 PGYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAENT 243 PGY EC HLLRLEGG E+VK RT+WRPKYA LG++G LPAE++ Sbjct: 391 PGYVECQHLLRLEGGAEIVKGRTEWRPKYANCLGTLGSLPAESS 434 >gb|ACQ57190.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 434 Score = 72.8 bits (177), Expect = 9e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -3 Query: 374 PGYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAENT 243 PGY EC HLLRLEGG E+VK RT+WRPKYA +G++G LPAE++ Sbjct: 391 PGYVECQHLLRLEGGAEIVKGRTEWRPKYANCVGTLGSLPAESS 434 >gb|ACQ57189.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 420 Score = 71.2 bits (173), Expect = 3e-10 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -3 Query: 374 PGYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAENT 243 PGY EC HLLRLEGG E+VK RT+WRPKYA +G++G LP E++ Sbjct: 377 PGYVECQHLLRLEGGAEIVKGRTEWRPKYANCVGTLGSLPTESS 420 >gb|AAX51636.1| chloroplast palmitoyl/oleoyl specific acyl-acyl carrier protein thioesterase precursor, partial [Diploknema butyracea] Length = 333 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 374 PGYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 PGY EC HLLRLE G E+VKART WRPKYA LGS G LPAE+ Sbjct: 290 PGYVECQHLLRLEDGAEIVKARTHWRPKYANCLGSHGQLPAES 332 >gb|AGC31683.1| chloroplast acyl-acylcarrier protein thioesterase B [Lonicera japonica] gi|441433569|gb|AGC31684.1| chloroplast acyl-acylcarrier protein thioesterase B [Lonicera japonica var. chinensis] Length = 422 Score = 69.3 bits (168), Expect = 1e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 374 PGYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAE 249 PG+ EC HLLRLEGG E+VK RT+WRPKY LG++G LPAE Sbjct: 379 PGHVECQHLLRLEGGAEIVKGRTEWRPKYPNRLGTLGALPAE 420 >ref|XP_011078334.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] gi|747063564|ref|XP_011078335.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] gi|747063566|ref|XP_011078336.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] gi|747063568|ref|XP_011078337.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] Length = 424 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G+ EC HLLRLEGGGE+VK RT WRPKYA +GS G LPAE+ Sbjct: 382 GFVECQHLLRLEGGGEIVKGRTQWRPKYADRIGSWGELPAES 423 >gb|AGC31686.1| chloroplast acyl-acylcarrier protein thioesterase B [Lonicera dasystyla] Length = 422 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 374 PGYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAE 249 PG+ EC HLLRLEGG E+VK RT+WRPKY LG+ G LPAE Sbjct: 379 PGHVECQHLLRLEGGAEIVKGRTEWRPKYPNRLGTPGALPAE 420 >gb|AGC31685.1| chloroplast acyl-acylcarrier protein thioesterase B [Lonicera hypoglauca] Length = 422 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 374 PGYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAE 249 PG+ EC HLLRLEGG E+VK RT+WRPKY L ++G LPAE Sbjct: 379 PGHVECQHLLRLEGGAEIVKGRTEWRPKYPNRLRTLGALPAE 420 >ref|XP_007013278.1| Fatty acyl-ACP thioesterases B isoform 2 [Theobroma cacao] gi|508783641|gb|EOY30897.1| Fatty acyl-ACP thioesterases B isoform 2 [Theobroma cacao] Length = 420 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G EC HLLRLE G E+V+ RT+WRPKYAKS G++G LPAE+ Sbjct: 378 GEIECQHLLRLEDGSEIVRGRTEWRPKYAKSFGNVGQLPAES 419 >ref|XP_007013277.1| Fatty acyl-ACP thioesterases B isoform 1 [Theobroma cacao] gi|508783640|gb|EOY30896.1| Fatty acyl-ACP thioesterases B isoform 1 [Theobroma cacao] Length = 426 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G EC HLLRLE G E+V+ RT+WRPKYAKS G++G LPAE+ Sbjct: 384 GEIECQHLLRLEDGSEIVRGRTEWRPKYAKSFGNVGQLPAES 425 >gb|ACQ57188.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 436 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 374 PGYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG 264 PGY EC HLLRLEGG E+VK RT+WRPKYA +G++G Sbjct: 391 PGYVECQHLLRLEGGAEIVKGRTEWRPKYANCVGTLG 427 >gb|AAX51637.1| chloroplast stearoyl/oleoyl specific acyl-acyl carrier protein thioesterase precursor, partial [Madhuca longifolia var. latifolia] Length = 333 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAENT 243 G+ EC HLLRLEGG E+VK RT+WRPKYA LG + LPA +T Sbjct: 291 GHVECQHLLRLEGGAEIVKGRTEWRPKYANRLGCLDQLPAGST 333 >emb|CBI28125.3| unnamed protein product [Vitis vinifera] Length = 408 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G EC HLLRLE G E+VK RT+WRPKYA S+G +G +PAE+ Sbjct: 366 GNVECQHLLRLEEGAEIVKGRTEWRPKYAHSMGGVGQIPAES 407 >ref|XP_002284850.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Vitis vinifera] Length = 421 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G EC HLLRLE G E+VK RT+WRPKYA S+G +G +PAE+ Sbjct: 379 GNVECQHLLRLEEGAEIVKGRTEWRPKYAHSMGGVGQIPAES 420 >emb|CDP20806.1| unnamed protein product [Coffea canephora] Length = 418 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPA 252 GY EC HLLRLE G E+VK RT WRPKYA +GS+G LPA Sbjct: 376 GYVECQHLLRLEDGAEIVKGRTVWRPKYANRIGSMGQLPA 415 >gb|AIX97815.1| fatty acyl-ACP thioesterase B [Prunus sibirica] Length = 417 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G EC HLLRLE G E+V+ RT+WRPKYA +LG +G LPAE+ Sbjct: 375 GGVECQHLLRLEEGAEIVRGRTEWRPKYANNLGIVGQLPAES 416 >ref|XP_008386232.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Malus domestica] gi|658054353|ref|XP_008362927.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Malus domestica] Length = 415 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G EC H+LRLE G E+V+ RT+WRPKYA +LG +G LPAE+ Sbjct: 373 GTVECQHMLRLEDGAEIVRGRTEWRPKYANNLGIVGHLPAES 414 >ref|XP_008242683.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Prunus mume] gi|645275172|ref|XP_008242684.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Prunus mume] Length = 417 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G EC HLLRLE G E+V+ RT+WRPKYA +LG +G LPAE+ Sbjct: 375 GGVECQHLLRLEEGAEIVRGRTEWRPKYANNLGIVGQLPAES 416 >ref|XP_007202158.1| hypothetical protein PRUPE_ppa006328mg [Prunus persica] gi|462397689|gb|EMJ03357.1| hypothetical protein PRUPE_ppa006328mg [Prunus persica] Length = 417 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G EC HLLRLE G E+V+ RT+WRPKYA +LG +G LPAE+ Sbjct: 375 GGVECQHLLRLEEGAEIVRGRTEWRPKYANNLGIVGQLPAES 416 >ref|XP_012448973.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Gossypium raimondii] gi|763739670|gb|KJB07169.1| hypothetical protein B456_001G003300 [Gossypium raimondii] gi|763739671|gb|KJB07170.1| hypothetical protein B456_001G003300 [Gossypium raimondii] Length = 420 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 371 GYAECHHLLRLEGGGEVVKARTDWRPKYAKSLGSIG*LPAEN 246 G EC HLL+LE G E+V+ RT WRPKYAKS G++G +PAE+ Sbjct: 378 GEIECQHLLQLEEGSEIVRGRTQWRPKYAKSFGNVGQIPAES 419