BLASTX nr result
ID: Cornus23_contig00019764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00019764 (361 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoe... 63 1e-07 >ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] gi|440800957|gb|ELR21983.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] Length = 224 Score = 62.8 bits (151), Expect = 1e-07 Identities = 36/117 (30%), Positives = 60/117 (51%) Frame = -2 Query: 360 WDHPDQTQYSLYAVNDQITCYTEQIDSKQYVPDFSNFTYVGQSLIDLEPVYEFADQSTRN 181 +DH +Q ++++ + TC+T+ I D S ++G+S + +PVY + ++ R Sbjct: 84 YDHSEQKMFAVFFRGEVATCFTKTIRGNLTHFDLSEAEFLGKSYVYFDPVYHWQLETDRY 143 Query: 180 PGEYYVYFETQEEEPFRFETIDENGFQIQSTFVEFDAGTQDQTLFEVPDIIKQTCNP 10 E + E E I NG T EFDAG+QD++LF + D +KQ+C P Sbjct: 144 HFELFDTPEPHRELRKVSFFIKPNGKAGSWTMHEFDAGSQDESLFMINDKVKQSCTP 200