BLASTX nr result
ID: Cornus23_contig00019668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00019668 (369 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM82534.1| hypothetical protein ANO11243_005160 [fungal sp.... 82 2e-13 >dbj|GAM82534.1| hypothetical protein ANO11243_005160 [fungal sp. No.11243] Length = 109 Score = 82.0 bits (201), Expect = 2e-13 Identities = 42/76 (55%), Positives = 50/76 (65%) Frame = -3 Query: 229 MMFATALRVAPRGIPASIATMRISGMQQAGLATIAVAAPAGILLGAPKWAPRAGDRADRF 50 MMFATA+R PR IPA+ A RIS QQA + T +V A +L+GAP WAPRAGDRA RF Sbjct: 1 MMFATAIRAVPRSIPAATAVSRISATQQAVMVTGSVGVWAAVLMGAPWWAPRAGDRATRF 60 Query: 49 FXXXXXXXXXMPKLKR 2 F +PKL+R Sbjct: 61 FERMGERIERLPKLRR 76