BLASTX nr result
ID: Cornus23_contig00019662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00019662 (302 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010548024.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_014510172.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_014496158.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 gb|KOM56473.1| hypothetical protein LR48_Vigan10g236500 [Vigna a... 106 6e-21 gb|KOM55412.1| hypothetical protein LR48_Vigan10g130400 [Vigna a... 106 6e-21 gb|KHN37503.1| Pentatricopeptide repeat-containing protein [Glyc... 106 6e-21 ref|XP_009772539.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_009607777.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 emb|CDO97760.1| unnamed protein product [Coffea canephora] 106 6e-21 gb|KDO59694.1| hypothetical protein CISIN_1g044791mg [Citrus sin... 106 6e-21 ref|XP_006487099.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_006346424.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_007156519.1| hypothetical protein PHAVU_003G292800g [Phas... 106 6e-21 ref|XP_006423031.1| hypothetical protein CICLE_v10028026mg [Citr... 106 6e-21 ref|XP_004505212.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_004505209.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_004230786.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 gb|AFK43832.1| unknown [Lotus japonicus] 106 6e-21 gb|AFK42502.1| unknown [Medicago truncatula] 106 6e-21 ref|XP_003529393.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 >ref|XP_010548024.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690 [Tarenaya hassleriana] Length = 580 Score = 107 bits (267), Expect = 4e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRI+GRELIVRDNKRFHHFR+G+CSCGDYW Sbjct: 532 RIIKNLRVCGDCHNAIKIMSRIIGRELIVRDNKRFHHFRDGKCSCGDYW 580 >ref|XP_014510172.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690 [Vigna radiata var. radiata] Length = 570 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 522 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 570 >ref|XP_014496158.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Vigna radiata var. radiata] gi|950953373|ref|XP_014496159.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Vigna radiata var. radiata] Length = 549 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 501 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 549 >gb|KOM56473.1| hypothetical protein LR48_Vigan10g236500 [Vigna angularis] Length = 569 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 521 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 569 >gb|KOM55412.1| hypothetical protein LR48_Vigan10g130400 [Vigna angularis] Length = 548 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 500 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 548 >gb|KHN37503.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 591 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 543 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 591 >ref|XP_009772539.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Nicotiana sylvestris] Length = 702 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 654 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 702 >ref|XP_009607777.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690 [Nicotiana tomentosiformis] Length = 659 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 611 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 659 >emb|CDO97760.1| unnamed protein product [Coffea canephora] Length = 566 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 518 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 566 >gb|KDO59694.1| hypothetical protein CISIN_1g044791mg [Citrus sinensis] Length = 623 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 575 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 623 >ref|XP_006487099.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Citrus sinensis] Length = 664 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 616 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 664 >ref|XP_006346424.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like isoform X1 [Solanum tuberosum] gi|565359241|ref|XP_006346425.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like isoform X2 [Solanum tuberosum] gi|565359243|ref|XP_006346426.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like isoform X3 [Solanum tuberosum] gi|565359245|ref|XP_006346427.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like isoform X4 [Solanum tuberosum] Length = 636 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 588 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 636 >ref|XP_007156519.1| hypothetical protein PHAVU_003G292800g [Phaseolus vulgaris] gi|561029873|gb|ESW28513.1| hypothetical protein PHAVU_003G292800g [Phaseolus vulgaris] Length = 571 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 523 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 571 >ref|XP_006423031.1| hypothetical protein CICLE_v10028026mg [Citrus clementina] gi|557524965|gb|ESR36271.1| hypothetical protein CICLE_v10028026mg [Citrus clementina] Length = 623 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 575 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 623 >ref|XP_004505212.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Cicer arietinum] Length = 567 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 519 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 567 >ref|XP_004505209.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690 [Cicer arietinum] Length = 567 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 519 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 567 >ref|XP_004230786.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690 [Solanum lycopersicum] Length = 636 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 588 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 636 >gb|AFK43832.1| unknown [Lotus japonicus] Length = 295 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 247 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 295 >gb|AFK42502.1| unknown [Medicago truncatula] Length = 565 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 517 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 565 >ref|XP_003529393.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Glycine max] gi|734399761|gb|KHN31069.1| Pentatricopeptide repeat-containing protein [Glycine soja] gi|947101776|gb|KRH50268.1| hypothetical protein GLYMA_07G211900 [Glycine max] Length = 588 Score = 106 bits (265), Expect = 6e-21 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 300 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFRNGECSCGDYW 154 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHF++G+CSCGDYW Sbjct: 540 RIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 588