BLASTX nr result
ID: Cornus23_contig00019402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00019402 (373 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME39384.1| hypothetical protein DOTSEDRAFT_28543 [Dothistrom... 62 1e-07 gb|KJX95386.1| hypothetical protein TI39_contig4116g00011 [Zymos... 58 2e-06 >gb|EME39384.1| hypothetical protein DOTSEDRAFT_28543 [Dothistroma septosporum NZE10] Length = 83 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 3/50 (6%) Frame = -1 Query: 199 MFAGMQDYKRD--SEAHAARRASLKDQTAAPSGGVLANMWNSTFKG-DKK 59 +F+GMQ+YKRD S A ARR SL+DQ+A PSG +LANMWNSTFKG DKK Sbjct: 35 LFSGMQEYKRDPNSAAGQARRESLQDQSAKPSG-MLANMWNSTFKGADKK 83 >gb|KJX95386.1| hypothetical protein TI39_contig4116g00011 [Zymoseptoria brevis] Length = 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 193 AGMQDYKRDSEAHAARRASLKDQTAAPSGGVLANMWNSTFKGDKK 59 AG Q++KR+S A ARRAS+KDQ APS GV++N+WNST KG K Sbjct: 24 AGFQEFKRESPAANARRASIKDQNTAPS-GVISNLWNSTMKGHAK 67