BLASTX nr result
ID: Cornus23_contig00019387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00019387 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005647960.1| hypothetical protein COCSUDRAFT_65904 [Cocco... 64 6e-08 >ref|XP_005647960.1| hypothetical protein COCSUDRAFT_65904 [Coccomyxa subellipsoidea C-169] gi|384249936|gb|EIE23416.1| hypothetical protein COCSUDRAFT_65904 [Coccomyxa subellipsoidea C-169] Length = 248 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/78 (42%), Positives = 45/78 (57%) Frame = -3 Query: 244 SMMSMQLTQSANLAGASLRSRAAPRVARQPFSVRAQSDPIAPKESAVPGDVIAYAKSLPG 65 +MMS ++ A S + AR+ V A P ++A P D++AYAK+LPG Sbjct: 4 TMMSTSSLRAPVARDAFRTSTKSSPAARKGLRVLALGPQAEPSKAATPDDILAYAKTLPG 63 Query: 64 ITQPFPQLFDPFNLLGNA 11 I+QPFP +FDP NLL NA Sbjct: 64 ISQPFPDIFDPANLLSNA 81