BLASTX nr result
ID: Cornus23_contig00019362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00019362 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO52562.1| hypothetical protein CISIN_1g015470mg [Citrus sin... 58 3e-06 ref|XP_006490199.1| PREDICTED: F-box protein At5g07610-like [Cit... 58 3e-06 ref|XP_009800259.1| PREDICTED: F-box protein At5g49610-like [Nic... 57 7e-06 gb|KDO37504.1| hypothetical protein CISIN_1g045078mg, partial [C... 56 9e-06 ref|NP_175213.1| putative F-box protein [Arabidopsis thaliana] g... 56 9e-06 >gb|KDO52562.1| hypothetical protein CISIN_1g015470mg [Citrus sinensis] Length = 406 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 178 DDLVTEILLRLPLNSVFKFKCVSKTWNHLISDPIFCSNYQSQRK 309 DDL+TEILLRLP+ S+ KFK VSK W LIS+P+FC RK Sbjct: 34 DDLLTEILLRLPIKSLLKFKSVSKHWLSLISNPVFCHRLSLTRK 77 >ref|XP_006490199.1| PREDICTED: F-box protein At5g07610-like [Citrus sinensis] Length = 369 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 178 DDLVTEILLRLPLNSVFKFKCVSKTWNHLISDPIFCSNYQSQRK 309 DDL+TEILLRLP+ S+ KFK VSK W LIS+P+FC RK Sbjct: 34 DDLLTEILLRLPIKSLLKFKSVSKHWLSLISNPVFCHRLSLTRK 77 >ref|XP_009800259.1| PREDICTED: F-box protein At5g49610-like [Nicotiana sylvestris] Length = 404 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = +1 Query: 178 DDLVTEILLRLPLNSVFKFKCVSKTWNHLISDPIFCSNYQSQRKNS 315 DD++ EIL+RLP+ S+ +FKCVSK+W LISDP F + + KN+ Sbjct: 60 DDIIMEILIRLPVKSLLQFKCVSKSWQALISDPYFKMKHLNHAKNN 105 >gb|KDO37504.1| hypothetical protein CISIN_1g045078mg, partial [Citrus sinensis] Length = 129 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +1 Query: 178 DDLVTEILLRLPLNSVFKFKCVSKTWNHLISDPIFCSNYQSQRK 309 DDL+TEIL+RLP+ S+ KFK VSK W LIS+P+FC RK Sbjct: 34 DDLLTEILIRLPIKSLLKFKSVSKHWLSLISNPVFCRRLSLIRK 77 >ref|NP_175213.1| putative F-box protein [Arabidopsis thaliana] gi|75263267|sp|Q9FZF8.1|FB44_ARATH RecName: Full=Putative F-box protein At1g47790 gi|9802587|gb|AAF99789.1|AC012463_6 T2E6.11 [Arabidopsis thaliana] gi|332194093|gb|AEE32214.1| putative F-box protein [Arabidopsis thaliana] Length = 389 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 2/49 (4%) Frame = +1 Query: 181 DLVTEILLRLPLNSVFKFKCVSKTWNHLISDPIFCSNY--QSQRKNSLL 321 DL +EILLRLP+ SV +F+CVSK W+ +I+DP F Y QS + SLL Sbjct: 28 DLASEILLRLPVKSVVRFRCVSKLWSSIITDPYFIKTYETQSSTRQSLL 76