BLASTX nr result
ID: Cornus23_contig00018925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00018925 (266 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344090.1| PREDICTED: cytochrome b-c1 complex subunit 8... 58 3e-06 sp|P46269.2|QCR8_SOLTU RecName: Full=Cytochrome b-c1 complex sub... 58 3e-06 ref|XP_006350896.1| PREDICTED: cytochrome b-c1 complex subunit 8... 57 4e-06 ref|XP_004242473.1| PREDICTED: cytochrome b-c1 complex subunit 8... 57 4e-06 ref|XP_009617853.1| PREDICTED: cytochrome b-c1 complex subunit 8... 57 5e-06 ref|XP_009590906.1| PREDICTED: cytochrome b-c1 complex subunit 8... 57 7e-06 ref|XP_010246044.1| PREDICTED: cytochrome b-c1 complex subunit 8... 56 9e-06 ref|XP_009793973.1| PREDICTED: cytochrome b-c1 complex subunit 8... 56 9e-06 >ref|XP_006344090.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum tuberosum] Length = 72 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 265 ISATLLLSPLVGTYGYVQHYMEKEKMEHRY 176 ISATLLL PLVGTY YVQH++EKEK+EHRY Sbjct: 43 ISATLLLGPLVGTYSYVQHFLEKEKLEHRY 72 >sp|P46269.2|QCR8_SOLTU RecName: Full=Cytochrome b-c1 complex subunit 8; AltName: Full=Complex III subunit 8; AltName: Full=Complex III subunit VII; AltName: Full=Ubiquinol-cytochrome c reductase complex 8.2 kDa protein; AltName: Full=Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C gi|633687|emb|CAA55862.1| ubiquinol--cytochrome c reductase [Solanum tuberosum] gi|1094912|prf||2107179A cytochrome c oxidase:SUBUNIT=8.2kD Length = 72 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 265 ISATLLLSPLVGTYGYVQHYMEKEKMEHRY 176 ISATLLL PLVGTY YVQH++EKEK+EHRY Sbjct: 43 ISATLLLGPLVGTYSYVQHFLEKEKLEHRY 72 >ref|XP_006350896.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum tuberosum] Length = 72 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 265 ISATLLLSPLVGTYGYVQHYMEKEKMEHRY 176 ISATLLL PL+GTY YVQH++EKEK+EHRY Sbjct: 43 ISATLLLGPLIGTYSYVQHFLEKEKLEHRY 72 >ref|XP_004242473.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Solanum lycopersicum] Length = 72 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 265 ISATLLLSPLVGTYGYVQHYMEKEKMEHRY 176 ISATLLL PL+GTY YVQH++EKEK+EHRY Sbjct: 43 ISATLLLGPLIGTYSYVQHFLEKEKLEHRY 72 >ref|XP_009617853.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Nicotiana tomentosiformis] gi|698494631|ref|XP_009793500.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Nicotiana sylvestris] Length = 72 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 265 ISATLLLSPLVGTYGYVQHYMEKEKMEHRY 176 ISATLLL+PLVGTY YVQH+ EKEK+EHRY Sbjct: 43 ISATLLLAPLVGTYSYVQHFKEKEKLEHRY 72 >ref|XP_009590906.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Nicotiana tomentosiformis] Length = 72 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 265 ISATLLLSPLVGTYGYVQHYMEKEKMEHRY 176 ISATLLL+PLVGTY YVQ+Y EKEK+EHRY Sbjct: 43 ISATLLLAPLVGTYSYVQYYQEKEKLEHRY 72 >ref|XP_010246044.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Nelumbo nucifera] Length = 72 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 265 ISATLLLSPLVGTYGYVQHYMEKEKMEHRY 176 ISA LLL+PLVGTY YVQHY EKEK+EHRY Sbjct: 43 ISAVLLLTPLVGTYTYVQHYQEKEKLEHRY 72 >ref|XP_009793973.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Nicotiana sylvestris] Length = 72 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 265 ISATLLLSPLVGTYGYVQHYMEKEKMEHRY 176 ISATLLL+PL+GTY YVQ+Y EKEK+EHRY Sbjct: 43 ISATLLLAPLIGTYSYVQYYQEKEKLEHRY 72