BLASTX nr result
ID: Cornus23_contig00018839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00018839 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008777500.1| PREDICTED: uncharacterized protein LOC103697... 59 1e-06 >ref|XP_008777500.1| PREDICTED: uncharacterized protein LOC103697430 [Phoenix dactylifera] Length = 246 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 3/72 (4%) Frame = +3 Query: 57 DLQTKVDGME---QAFKDKGPATISDLVHKTNLPFSSHVMALPLPKRFKMPHLESFDGTR 227 +L KV+ +E Q +D+ P D+ T PF V P+P+RFKMP +E +DG+ Sbjct: 6 ELNRKVEELERQIQTLRDQAPRRDVDVDFTTESPFPRSVADEPIPQRFKMPQMEPYDGSS 65 Query: 228 DLLDHLEVFKSL 263 D LDHLE +K+L Sbjct: 66 DPLDHLESYKAL 77