BLASTX nr result
ID: Cornus23_contig00018419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00018419 (347 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW55427.1| hypothetical protein EUGRSUZ_I01330 [Eucalyptus g... 90 6e-16 >gb|KCW55427.1| hypothetical protein EUGRSUZ_I01330 [Eucalyptus grandis] Length = 121 Score = 90.1 bits (222), Expect = 6e-16 Identities = 43/53 (81%), Positives = 44/53 (83%) Frame = +1 Query: 1 GQGVDLGASTLSLMRSIFFSFFGLELPYDPLNLFPFFVLLSPRPHRIGNAAAA 159 GQGVDLG STLSLMRSIFFSFFG PYDPLNLFPFFV LSP PHR G+ AA Sbjct: 7 GQGVDLGTSTLSLMRSIFFSFFGRAFPYDPLNLFPFFVRLSPLPHRTGSGGAA 59