BLASTX nr result
ID: Cornus23_contig00018075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00018075 (299 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003857722.1| 40S ribosomal protein S21 [Zymoseptoria trit... 136 5e-30 ref|XP_007782619.1| 40S ribosomal protein S21 [Coniosporium apol... 130 5e-28 gb|EME46176.1| hypothetical protein DOTSEDRAFT_70238 [Dothistrom... 129 9e-28 ref|XP_003013466.1| hypothetical protein ARB_00284 [Arthroderma ... 128 2e-27 ref|XP_002845792.1| 40S ribosomal protein S21 [Arthroderma otae ... 128 2e-27 gb|EKG13078.1| Ribosomal protein S21e [Macrophomina phaseolina MS6] 126 6e-27 ref|XP_007582189.1| putative 40s ribosomal protein s21 protein [... 125 1e-26 gb|KKY25855.1| putative 40s ribosomal protein s21 [Diplodia seri... 125 1e-26 ref|XP_012741178.1| 40S ribosomal protein S21 [Pseudogymnoascus ... 125 2e-26 gb|KIM97888.1| hypothetical protein OIDMADRAFT_20286 [Oidiodendr... 124 2e-26 ref|XP_001245058.1| 40S ribosomal protein S21 [Coccidioides immi... 124 2e-26 gb|KIV95831.1| 40S ribosomal protein S21 [Exophiala mesophila] 124 3e-26 ref|XP_007925884.1| hypothetical protein MYCFIDRAFT_58234 [Pseud... 124 4e-26 ref|XP_003834645.1| hypothetical protein LEMA_P067880.1 [Leptosp... 124 4e-26 ref|XP_013258870.1| 40S ribosomal protein S21 [Exophiala aquamar... 123 5e-26 ref|XP_008088530.1| 40S ribosomal protein S21 [Glarea lozoyensis... 123 5e-26 ref|XP_007291375.1| 40S ribosomal protein S21 [Marssonina brunne... 123 5e-26 ref|XP_001540658.1| 40S ribosomal protein S21 [Histoplasma capsu... 123 5e-26 dbj|GAM85388.1| hypothetical protein ANO11243_033950 [fungal sp.... 123 6e-26 gb|EPQ67839.1| Protein component of the small ribosomal subunit ... 123 6e-26 >ref|XP_003857722.1| 40S ribosomal protein S21 [Zymoseptoria tritici IPO323] gi|339477607|gb|EGP92698.1| hypothetical protein MYCGRDRAFT_78124 [Zymoseptoria tritici IPO323] gi|796705125|gb|KJX96887.1| 40s ribosomal protein s21 [Zymoseptoria brevis] Length = 86 Score = 136 bits (343), Expect = 5e-30 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDS+NRLAQRDGFL Sbjct: 19 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSINRLAQRDGFL 78 Query: 119 KGVWSGSR 96 KGVWSGSR Sbjct: 79 KGVWSGSR 86 >ref|XP_007782619.1| 40S ribosomal protein S21 [Coniosporium apollinis CBS 100218] gi|494830787|gb|EON67302.1| 40S ribosomal protein S21 [Coniosporium apollinis CBS 100218] Length = 86 Score = 130 bits (326), Expect = 5e-28 Identities = 63/68 (92%), Positives = 65/68 (95%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQISVGKVDENGRYTG+NQ YAL GFVRAMGESDDS+NRLAQRDGFL Sbjct: 19 ATNRIIKAKDHASVQISVGKVDENGRYTGDNQTYALCGFVRAMGESDDSLNRLAQRDGFL 78 Query: 119 KGVWSGSR 96 KGVWS SR Sbjct: 79 KGVWSASR 86 >gb|EME46176.1| hypothetical protein DOTSEDRAFT_70238 [Dothistroma septosporum NZE10] Length = 86 Score = 129 bits (324), Expect = 9e-28 Identities = 63/68 (92%), Positives = 65/68 (95%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYAL GFVRAMGESDD +NRLAQRDGF+ Sbjct: 19 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALCGFVRAMGESDDCVNRLAQRDGFV 78 Query: 119 KGVWSGSR 96 K VWSGSR Sbjct: 79 KSVWSGSR 86 >ref|XP_003013466.1| hypothetical protein ARB_00284 [Arthroderma benhamiae CBS 112371] gi|302654636|ref|XP_003019120.1| hypothetical protein TRV_06859 [Trichophyton verrucosum HKI 0517] gi|315051706|ref|XP_003175227.1| 40S ribosomal protein S21 [Microsporum gypseum CBS 118893] gi|291177030|gb|EFE32826.1| hypothetical protein ARB_00284 [Arthroderma benhamiae CBS 112371] gi|291182821|gb|EFE38475.1| hypothetical protein TRV_06859 [Trichophyton verrucosum HKI 0517] gi|311340542|gb|EFQ99744.1| 40S ribosomal protein S21 [Microsporum gypseum CBS 118893] gi|326474210|gb|EGD98219.1| ribosomal protein S21e [Trichophyton tonsurans CBS 112818] gi|326477632|gb|EGE01642.1| 40S ribosomal protein S21 [Trichophyton equinum CBS 127.97] Length = 79 Score = 128 bits (321), Expect = 2e-27 Identities = 62/68 (91%), Positives = 64/68 (94%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQIS+ KVDENGRYTGENQVYALSGFVRAMGE DDS+NRLAQRDGFL Sbjct: 12 ATNRIIKAKDHASVQISIAKVDENGRYTGENQVYALSGFVRAMGEGDDSLNRLAQRDGFL 71 Query: 119 KGVWSGSR 96 K VWS SR Sbjct: 72 KNVWSASR 79 >ref|XP_002845792.1| 40S ribosomal protein S21 [Arthroderma otae CBS 113480] gi|327296321|ref|XP_003232855.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 118892] gi|238843180|gb|EEQ32842.1| 40S ribosomal protein S21 [Arthroderma otae CBS 113480] gi|326465166|gb|EGD90619.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 118892] gi|607880847|gb|EZF25658.1| 40S ribosomal protein S21 [Trichophyton rubrum MR850] gi|607880848|gb|EZF25659.1| 40S ribosomal protein S21 [Trichophyton rubrum MR850] gi|607888970|gb|EZF29568.1| 40S ribosomal protein S21 [Trichophyton interdigitale H6] gi|607907502|gb|EZF44628.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 100081] gi|607907503|gb|EZF44629.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 100081] gi|607919559|gb|EZF55252.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 288.86] gi|607919560|gb|EZF55253.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 288.86] gi|607931639|gb|EZF65890.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 289.86] gi|607931640|gb|EZF65891.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 289.86] gi|607943629|gb|EZF76588.1| 40S ribosomal protein S21 [Trichophyton soudanense CBS 452.61] gi|607943630|gb|EZF76589.1| 40S ribosomal protein S21 [Trichophyton soudanense CBS 452.61] gi|607955638|gb|EZF87168.1| 40S ribosomal protein S21 [Trichophyton rubrum MR1448] gi|607955639|gb|EZF87169.1| 40S ribosomal protein S21 [Trichophyton rubrum MR1448] gi|607968003|gb|EZF98109.1| 40S ribosomal protein S21 [Trichophyton rubrum MR1459] gi|607968004|gb|EZF98110.1| 40S ribosomal protein S21 [Trichophyton rubrum MR1459] gi|607980074|gb|EZG09046.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 735.88] gi|607980075|gb|EZG09047.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 735.88] gi|607992027|gb|EZG19661.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 202.88] gi|607992028|gb|EZG19662.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 202.88] gi|633050755|gb|KDB26678.1| 40S ribosomal protein S21 [Trichophyton interdigitale MR816] gi|633061970|gb|KDB36384.1| 40S ribosomal protein S21 [Trichophyton rubrum D6] gi|633061971|gb|KDB36385.1| 40S ribosomal protein S21 [Trichophyton rubrum D6] gi|674809083|gb|KFL62486.1| 40S ribosomal protein S21 [Trichophyton rubrum CBS 118892] gi|861296580|gb|KMQ41150.1| Ribosomal protein S21e, conserved site [Trichophyton rubrum] Length = 86 Score = 128 bits (321), Expect = 2e-27 Identities = 62/68 (91%), Positives = 64/68 (94%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQIS+ KVDENGRYTGENQVYALSGFVRAMGE DDS+NRLAQRDGFL Sbjct: 19 ATNRIIKAKDHASVQISIAKVDENGRYTGENQVYALSGFVRAMGEGDDSLNRLAQRDGFL 78 Query: 119 KGVWSGSR 96 K VWS SR Sbjct: 79 KNVWSASR 86 >gb|EKG13078.1| Ribosomal protein S21e [Macrophomina phaseolina MS6] Length = 86 Score = 126 bits (317), Expect = 6e-27 Identities = 61/68 (89%), Positives = 63/68 (92%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHAS QIS+GKVDENGRYTGENQ YAL GFVRAMGESDDS+NRLAQRDGFL Sbjct: 19 ATNRIIKAKDHASAQISIGKVDENGRYTGENQTYALCGFVRAMGESDDSINRLAQRDGFL 78 Query: 119 KGVWSGSR 96 K VWS SR Sbjct: 79 KNVWSASR 86 >ref|XP_007582189.1| putative 40s ribosomal protein s21 protein [Neofusicoccum parvum UCRNP2] gi|485925841|gb|EOD50325.1| putative 40s ribosomal protein s21 protein [Neofusicoccum parvum UCRNP2] Length = 86 Score = 125 bits (315), Expect = 1e-26 Identities = 61/68 (89%), Positives = 63/68 (92%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQIS+ KVDENGRYTGENQ YAL GFVRAMGESDDS+NRLAQRDGFL Sbjct: 19 ATNRIIKAKDHASVQISIAKVDENGRYTGENQTYALCGFVRAMGESDDSINRLAQRDGFL 78 Query: 119 KGVWSGSR 96 K VWS SR Sbjct: 79 KSVWSASR 86 >gb|KKY25855.1| putative 40s ribosomal protein s21 [Diplodia seriata] Length = 86 Score = 125 bits (314), Expect = 1e-26 Identities = 61/68 (89%), Positives = 63/68 (92%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRII+AKDHASVQISVGKVDENGRYTGENQ YAL GFVRAMGESDDS+NRL QRDGFL Sbjct: 19 ATNRIIQAKDHASVQISVGKVDENGRYTGENQTYALCGFVRAMGESDDSINRLTQRDGFL 78 Query: 119 KGVWSGSR 96 K VWS SR Sbjct: 79 KSVWSASR 86 >ref|XP_012741178.1| 40S ribosomal protein S21 [Pseudogymnoascus destructans 20631-21] gi|440637969|gb|ELR07888.1| 40S ribosomal protein S21 [Pseudogymnoascus destructans 20631-21] Length = 88 Score = 125 bits (313), Expect = 2e-26 Identities = 60/68 (88%), Positives = 64/68 (94%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQISVGKVD+NGRYTGENQVYAL GFVR+MGESDDS+NRLAQRDG L Sbjct: 19 ATNRIIKAKDHASVQISVGKVDDNGRYTGENQVYALCGFVRSMGESDDSLNRLAQRDGLL 78 Query: 119 KGVWSGSR 96 K VWSG + Sbjct: 79 KSVWSGQQ 86 >gb|KIM97888.1| hypothetical protein OIDMADRAFT_20286 [Oidiodendron maius Zn] Length = 88 Score = 124 bits (312), Expect = 2e-26 Identities = 60/67 (89%), Positives = 64/67 (95%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQIS+GKVDENGR+TGE+QVYAL GFVRAMGESDDS+NRLAQRDG L Sbjct: 19 ATNRIIKAKDHASVQISIGKVDENGRFTGESQVYALCGFVRAMGESDDSLNRLAQRDGLL 78 Query: 119 KGVWSGS 99 K VWSGS Sbjct: 79 KNVWSGS 85 >ref|XP_001245058.1| 40S ribosomal protein S21 [Coccidioides immitis RS] gi|303323487|ref|XP_003071735.1| 40S ribosomal protein S21 [Coccidioides posadasii C735 delta SOWgp] gi|240111437|gb|EER29590.1| 40S ribosomal protein S21, putative [Coccidioides posadasii C735 delta SOWgp] gi|320035129|gb|EFW17071.1| 40S ribosomal protein S21 [Coccidioides posadasii str. Silveira] gi|767019892|gb|EAS33475.3| 40S ribosomal protein S21 [Coccidioides immitis RS] gi|855535334|gb|KMM69983.1| 40S ribosomal protein S21 [Coccidioides posadasii RMSCC 3488] gi|859410454|gb|KMP04640.1| 40S ribosomal protein S21 [Coccidioides immitis RMSCC 2394] gi|875286477|gb|KMU80144.1| 40S ribosomal protein S21 [Coccidioides immitis RMSCC 3703] gi|875646212|gb|KMU88970.1| 40S ribosomal protein S21 [Coccidioides immitis H538.4] Length = 88 Score = 124 bits (312), Expect = 2e-26 Identities = 61/67 (91%), Positives = 62/67 (92%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYAL GFVRA GE DDS+NRLAQRDGFL Sbjct: 19 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALCGFVRARGEGDDSLNRLAQRDGFL 78 Query: 119 KGVWSGS 99 K VWS S Sbjct: 79 KNVWSAS 85 >gb|KIV95831.1| 40S ribosomal protein S21 [Exophiala mesophila] Length = 88 Score = 124 bits (311), Expect = 3e-26 Identities = 61/65 (93%), Positives = 62/65 (95%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRA ESDDS+NRLAQRDGFL Sbjct: 19 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRARAESDDSLNRLAQRDGFL 78 Query: 119 KGVWS 105 K VWS Sbjct: 79 KNVWS 83 >ref|XP_007925884.1| hypothetical protein MYCFIDRAFT_58234 [Pseudocercospora fijiensis CIRAD86] gi|452983014|gb|EME82772.1| hypothetical protein MYCFIDRAFT_58234 [Pseudocercospora fijiensis CIRAD86] Length = 86 Score = 124 bits (310), Expect = 4e-26 Identities = 60/68 (88%), Positives = 64/68 (94%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 AT+RIIKAKDHASVQISVG VDENGRYTGEN+VYAL GFVRAMGESDD +NRLAQRDG+L Sbjct: 19 ATSRIIKAKDHASVQISVGNVDENGRYTGENKVYALCGFVRAMGESDDCINRLAQRDGYL 78 Query: 119 KGVWSGSR 96 KGVWS SR Sbjct: 79 KGVWSASR 86 >ref|XP_003834645.1| hypothetical protein LEMA_P067880.1 [Leptosphaeria maculans JN3] gi|312211195|emb|CBX91280.1| hypothetical protein LEMA_P067880.1 [Leptosphaeria maculans JN3] Length = 135 Score = 124 bits (310), Expect = 4e-26 Identities = 60/68 (88%), Positives = 62/68 (91%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 AT RIIKAKDHASVQ+SVGKVDENGRYTGENQVYAL GFVRAMGESDDS NRL Q+DGFL Sbjct: 68 ATGRIIKAKDHASVQLSVGKVDENGRYTGENQVYALCGFVRAMGESDDSFNRLTQKDGFL 127 Query: 119 KGVWSGSR 96 K VWS SR Sbjct: 128 KSVWSASR 135 >ref|XP_013258870.1| 40S ribosomal protein S21 [Exophiala aquamarina CBS 119918] gi|656910621|gb|KEF56280.1| 40S ribosomal protein S21 [Exophiala aquamarina CBS 119918] Length = 88 Score = 123 bits (309), Expect = 5e-26 Identities = 60/66 (90%), Positives = 62/66 (93%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYAL GFVR+ ESDDS+NRLAQRDGFL Sbjct: 19 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALCGFVRSRAESDDSLNRLAQRDGFL 78 Query: 119 KGVWSG 102 K VWSG Sbjct: 79 KSVWSG 84 >ref|XP_008088530.1| 40S ribosomal protein S21 [Glarea lozoyensis ATCC 20868] gi|512195604|gb|EPE24442.1| 40S ribosomal protein S21 [Glarea lozoyensis ATCC 20868] Length = 88 Score = 123 bits (309), Expect = 5e-26 Identities = 61/67 (91%), Positives = 63/67 (94%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQISVGKVDENGR TGE+QVYAL GFVRAMGESDDS+NRLAQRDG L Sbjct: 19 ATNRIIKAKDHASVQISVGKVDENGRLTGESQVYALCGFVRAMGESDDSLNRLAQRDGLL 78 Query: 119 KGVWSGS 99 K VWSGS Sbjct: 79 KNVWSGS 85 >ref|XP_007291375.1| 40S ribosomal protein S21 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865451|gb|EKD18493.1| 40S ribosomal protein S21 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 88 Score = 123 bits (309), Expect = 5e-26 Identities = 59/67 (88%), Positives = 64/67 (95%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQIS+GKVDENGR+TGE+QVYAL GFVRAMGESDDS+NRLAQRDG L Sbjct: 19 ATNRIIKAKDHASVQISIGKVDENGRFTGESQVYALCGFVRAMGESDDSLNRLAQRDGLL 78 Query: 119 KGVWSGS 99 K VW+GS Sbjct: 79 KNVWTGS 85 >ref|XP_001540658.1| 40S ribosomal protein S21 [Histoplasma capsulatum NAm1] gi|150412601|gb|EDN07988.1| ribosomal protein S21e [Histoplasma capsulatum NAm1] gi|225562692|gb|EEH10971.1| 40S ribosomal protein S21 [Histoplasma capsulatum G186AR] Length = 88 Score = 123 bits (309), Expect = 5e-26 Identities = 60/67 (89%), Positives = 62/67 (92%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQIS+ KVDENGRYTGENQVYAL GFVRA GESDDS+NRLAQRDGFL Sbjct: 19 ATNRIIKAKDHASVQISIAKVDENGRYTGENQVYALCGFVRARGESDDSLNRLAQRDGFL 78 Query: 119 KGVWSGS 99 K VWS S Sbjct: 79 KNVWSAS 85 >dbj|GAM85388.1| hypothetical protein ANO11243_033950 [fungal sp. No.11243] Length = 147 Score = 123 bits (308), Expect = 6e-26 Identities = 59/68 (86%), Positives = 62/68 (91%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQIS+ KVDENGRYTGENQ YAL GFVRAMGESDD+ NRLAQRDG+L Sbjct: 19 ATNRIIKAKDHASVQISIAKVDENGRYTGENQTYALCGFVRAMGESDDAFNRLAQRDGYL 78 Query: 119 KGVWSGSR 96 K VWS SR Sbjct: 79 KSVWSASR 86 >gb|EPQ67839.1| Protein component of the small ribosomal subunit [Blumeria graminis f. sp. tritici 96224] gi|528295551|emb|CCU77966.1| 40S ribosomal protein S21 [Blumeria graminis f. sp. hordei DH14] Length = 88 Score = 123 bits (308), Expect = 6e-26 Identities = 61/67 (91%), Positives = 63/67 (94%) Frame = -1 Query: 299 ATNRIIKAKDHASVQISVGKVDENGRYTGENQVYALSGFVRAMGESDDSMNRLAQRDGFL 120 ATNRIIKAKDHASVQISV KVDENGR TGE+QVYALSGFVRAMGESDDS+NRLAQRDG L Sbjct: 19 ATNRIIKAKDHASVQISVAKVDENGRITGESQVYALSGFVRAMGESDDSLNRLAQRDGLL 78 Query: 119 KGVWSGS 99 K VWSGS Sbjct: 79 KNVWSGS 85