BLASTX nr result
ID: Cornus23_contig00018006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00018006 (263 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308947.1| 3' exoribonuclease domain 1-containing famil... 74 4e-11 ref|XP_011048048.1| PREDICTED: exosome complex component RRP43-l... 74 6e-11 emb|CDP08415.1| unnamed protein product [Coffea canephora] 74 6e-11 ref|XP_006381009.1| hypothetical protein POPTR_0006s04970g [Popu... 74 6e-11 emb|CDP19205.1| unnamed protein product [Coffea canephora] 73 1e-10 ref|XP_002322717.1| 3' exoribonuclease domain 1-containing famil... 73 1e-10 ref|XP_006373782.1| hypothetical protein POPTR_0016s05590g [Popu... 73 1e-10 ref|XP_009780009.1| PREDICTED: exosome complex component RRP43 [... 72 2e-10 ref|XP_009597188.1| PREDICTED: exosome complex component RRP43 [... 72 2e-10 ref|XP_002532079.1| exosome complex exonuclease rrp43, putative ... 70 8e-10 ref|XP_011033330.1| PREDICTED: exosome complex component RRP43-l... 69 2e-09 gb|KCW87871.1| hypothetical protein EUGRSUZ_A00266 [Eucalyptus g... 68 2e-09 gb|KCW87870.1| hypothetical protein EUGRSUZ_A00265 [Eucalyptus g... 68 2e-09 gb|KHN14032.1| Exosome complex component RRP43 [Glycine soja] 68 3e-09 ref|NP_001275073.1| 3'-5'-exoribonuclease/RNA binding protein-li... 68 3e-09 ref|XP_006351314.1| PREDICTED: exosome complex component RRP43 [... 68 3e-09 ref|XP_003531860.1| PREDICTED: exosome complex component RRP43-l... 68 3e-09 ref|XP_008460773.1| PREDICTED: exosome complex component RRP43 i... 67 7e-09 ref|XP_008460772.1| PREDICTED: exosome complex component RRP43 i... 67 7e-09 emb|CBI29839.3| unnamed protein product [Vitis vinifera] 65 2e-08 >ref|XP_002308947.1| 3' exoribonuclease domain 1-containing family protein [Populus trichocarpa] gi|222854923|gb|EEE92470.1| 3' exoribonuclease domain 1-containing family protein [Populus trichocarpa] Length = 318 Score = 73.9 bits (180), Expect = 4e-11 Identities = 38/58 (65%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -2 Query: 232 CKFQL-YVSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 C Q+ VSLNDDG++ LVSE DG KLE EPVNK+KR L L SIPFSLTC+L +N I Sbjct: 190 CAVQIPIVSLNDDGKIVLVSEEDDGTKLEEEPVNKEKRKLTLSSIPFSLTCILHKNYI 247 >ref|XP_011048048.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] gi|743909153|ref|XP_011048049.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] Length = 303 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDG++ LVSE DG KLE EPVNK+KR L L SIPFSLTC+L +N I Sbjct: 182 VSLNDDGKIVLVSEEDDGTKLEDEPVNKEKRKLTLSSIPFSLTCILHKNYI 232 >emb|CDP08415.1| unnamed protein product [Coffea canephora] Length = 310 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLND+GR+ LVSE + GGKLE EPVNK+KR L L +IPFSLTC+L +N I Sbjct: 189 VSLNDEGRIVLVSEDNGGGKLEKEPVNKEKRKLNLATIPFSLTCVLHKNYI 239 >ref|XP_006381009.1| hypothetical protein POPTR_0006s04970g [Populus trichocarpa] gi|550335486|gb|ERP58806.1| hypothetical protein POPTR_0006s04970g [Populus trichocarpa] Length = 303 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDG++ LVSE DG KLE EPVNK+KR L L SIPFSLTC+L +N I Sbjct: 182 VSLNDDGKIVLVSEEDDGTKLEEEPVNKEKRKLTLSSIPFSLTCILHKNYI 232 >emb|CDP19205.1| unnamed protein product [Coffea canephora] Length = 172 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLND+GR+ L+SE + GGKLE EPVNK+KR LKL +IP SLTC+L +N I Sbjct: 51 VSLNDEGRIVLISEDNGGGKLEKEPVNKEKRKLKLATIPLSLTCILHKNYI 101 >ref|XP_002322717.1| 3' exoribonuclease domain 1-containing family protein [Populus trichocarpa] gi|222867347|gb|EEF04478.1| 3' exoribonuclease domain 1-containing family protein [Populus trichocarpa] Length = 439 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDG++ LVSE +G KLE EPVNK+KR L L SIPFSLTC+L +N I Sbjct: 202 VSLNDDGKIVLVSEEDEGAKLEKEPVNKEKRKLTLSSIPFSLTCILHKNYI 252 >ref|XP_006373782.1| hypothetical protein POPTR_0016s05590g [Populus trichocarpa] gi|550320907|gb|ERP51579.1| hypothetical protein POPTR_0016s05590g [Populus trichocarpa] Length = 323 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDG++ LVSE +G KLE EPVNK+KR L L SIPFSLTC+L +N I Sbjct: 202 VSLNDDGKIVLVSEEDEGAKLEKEPVNKEKRKLTLSSIPFSLTCILHKNYI 252 >ref|XP_009780009.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris] gi|698422013|ref|XP_009780016.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris] gi|698422019|ref|XP_009780020.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris] gi|698422026|ref|XP_009780025.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris] Length = 303 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDGR+ LVSE + GKLE EPVNK+KR LKL S PFSLTC+L +N I Sbjct: 182 VSLNDDGRIVLVSEDNVRGKLEKEPVNKEKRKLKLNSPPFSLTCILHKNYI 232 >ref|XP_009597188.1| PREDICTED: exosome complex component RRP43 [Nicotiana tomentosiformis] Length = 303 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDGR+ LVSE + GKLE EPVNK+KR LKL S PFSLTC+L +N I Sbjct: 182 VSLNDDGRIVLVSEDNVRGKLEKEPVNKEKRKLKLNSPPFSLTCILHKNYI 232 >ref|XP_002532079.1| exosome complex exonuclease rrp43, putative [Ricinus communis] gi|223528261|gb|EEF30313.1| exosome complex exonuclease rrp43, putative [Ricinus communis] Length = 303 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDG+V +VS+ ++GGK E E VNK+KR L LRS+PFSLTC+L +N I Sbjct: 182 VSLNDDGKVVVVSDENEGGKREKEAVNKEKRKLTLRSLPFSLTCVLHKNYI 232 >ref|XP_011033330.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] gi|743869618|ref|XP_011033331.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] gi|743869620|ref|XP_011033332.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] gi|743869624|ref|XP_011033333.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] Length = 302 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDG++ LVSE +G KLE EPVNK+KR L L SIPFSLTC+L +N I Sbjct: 182 VSLNDDGKIVLVSEEDEGAKLE-EPVNKEKRKLTLSSIPFSLTCILHKNYI 231 >gb|KCW87871.1| hypothetical protein EUGRSUZ_A00266 [Eucalyptus grandis] Length = 249 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/53 (62%), Positives = 43/53 (81%) Frame = -2 Query: 220 LYVSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 L VSLND+GR+ +VSE +G KL+ EPV+K++R L L+SIPFSLTC+L RN I Sbjct: 139 LVVSLNDEGRMVMVSEELEGEKLDKEPVDKERRKLLLKSIPFSLTCILHRNYI 191 >gb|KCW87870.1| hypothetical protein EUGRSUZ_A00265 [Eucalyptus grandis] Length = 266 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRISRY 53 VSLND+GR+ +VSE +G KL+ EPV+K++R L L+SIPFSLTC+L RN I Y Sbjct: 175 VSLNDEGRMVMVSEELEGEKLDKEPVDKERRKLLLKSIPFSLTCILHRNYILPY 228 >gb|KHN14032.1| Exosome complex component RRP43 [Glycine soja] Length = 302 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 V++NDDG++ LVSE DG K E EPVNK+KR L LRSIPFSLTC+L +N I Sbjct: 182 VAMNDDGKIVLVSE-EDGQKREQEPVNKEKRKLTLRSIPFSLTCILHKNYI 231 >ref|NP_001275073.1| 3'-5'-exoribonuclease/RNA binding protein-like protein [Solanum tuberosum] gi|83283957|gb|ABC01886.1| 3'-5'-exoribonuclease/RNA binding protein-like protein [Solanum tuberosum] Length = 314 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDGR+ LVSE + KLE EPVN +KR LKL S+PFSLTC+L +N I Sbjct: 182 VSLNDDGRIVLVSEDTVRLKLEKEPVNTEKRKLKLNSLPFSLTCILHKNYI 232 >ref|XP_006351314.1| PREDICTED: exosome complex component RRP43 [Solanum tuberosum] Length = 303 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLNDDGR+ LVSE + KLE EPVN +KR LKL S+PFSLTC+L +N I Sbjct: 182 VSLNDDGRIVLVSEDTVRLKLEKEPVNTEKRKLKLNSLPFSLTCILHKNYI 232 >ref|XP_003531860.1| PREDICTED: exosome complex component RRP43-like [Glycine max] gi|947096468|gb|KRH45053.1| hypothetical protein GLYMA_08G246800 [Glycine max] Length = 302 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 V++NDDG++ LVSE DG K E EPVNK+KR L LRSIPFSLTC+L +N I Sbjct: 182 VAMNDDGKIVLVSE-EDGQKREQEPVNKEKRKLTLRSIPFSLTCILHKNYI 231 >ref|XP_008460773.1| PREDICTED: exosome complex component RRP43 isoform X2 [Cucumis melo] gi|659121685|ref|XP_008460774.1| PREDICTED: exosome complex component RRP43 isoform X2 [Cucumis melo] Length = 304 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 V+LNDDGRV VSE G E EPVNK+KR LKL S+PFSLTC+L + I Sbjct: 183 VALNDDGRVVFVSEEEGGENFEKEPVNKEKRKLKLNSVPFSLTCLLHKKYI 233 >ref|XP_008460772.1| PREDICTED: exosome complex component RRP43 isoform X1 [Cucumis melo] Length = 316 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 V+LNDDGRV VSE G E EPVNK+KR LKL S+PFSLTC+L + I Sbjct: 195 VALNDDGRVVFVSEEEGGENFEKEPVNKEKRKLKLNSVPFSLTCLLHKKYI 245 >emb|CBI29839.3| unnamed protein product [Vitis vinifera] Length = 311 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = -2 Query: 214 VSLNDDGRVELVSEGSDGGKLETEPVNKDKRTLKLRSIPFSLTCMLRRNRI 62 VSLN++GRV +VSE ++ GK E EPVNK KR L L S+PFSLTC+L +N I Sbjct: 190 VSLNEEGRVVVVSEENEEGKSEKEPVNKGKRKLTLSSLPFSLTCILHKNYI 240