BLASTX nr result
ID: Cornus23_contig00017576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00017576 (387 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [... 54 6e-08 ref|XP_008467004.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b... 47 4e-06 >emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus aureus subsp. aureus] Length = 267 Score = 53.5 bits (127), Expect(2) = 6e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -2 Query: 137 FQTFYYICVATSIWVFLLELYEVKFSYTVLRGG 39 FQTFY I V+ + WVFL ELYE+KFSYTVL GG Sbjct: 14 FQTFYSISVSANTWVFLFELYEMKFSYTVLGGG 46 Score = 30.0 bits (66), Expect(2) = 6e-08 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 33 TYLNKVYDWFE 1 TYLNKVYDWFE Sbjct: 51 TYLNKVYDWFE 61 >ref|XP_008467004.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b6, partial [Cucumis melo] Length = 260 Score = 47.0 bits (110), Expect(2) = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 122 YICVATSIWVFLLELYEVKFSYTVLRGGIP 33 +I V + IWVFL E YE KFSYTVLRGG P Sbjct: 12 HISVTSGIWVFLFEPYETKFSYTVLRGGSP 41 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 13/16 (81%), Positives = 14/16 (87%), Gaps = 2/16 (12%) Frame = -1 Query: 42 GNP--TYLNKVYDWFE 1 G+P TYLNKVYDWFE Sbjct: 39 GSPWFTYLNKVYDWFE 54