BLASTX nr result
ID: Cornus23_contig00017406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00017406 (543 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010036162.1| PREDICTED: pre-mRNA-processing factor 39 iso... 60 8e-07 ref|XP_010036158.1| PREDICTED: pre-mRNA-processing factor 39 iso... 60 8e-07 ref|XP_010036157.1| PREDICTED: pre-mRNA-processing factor 39 iso... 60 8e-07 emb|CDP03793.1| unnamed protein product [Coffea canephora] 59 2e-06 >ref|XP_010036162.1| PREDICTED: pre-mRNA-processing factor 39 isoform X4 [Eucalyptus grandis] Length = 723 Score = 59.7 bits (143), Expect = 8e-07 Identities = 37/75 (49%), Positives = 43/75 (57%) Frame = -2 Query: 227 FMQVCSYLPNHLSVRQGGSLLSYLRGLPVPPMEYSLCISPKFPLFVLFI*FCSFELELCD 48 F +V +YLPNHLSVRQGGSLLSYLRGL +P S P + LF+ + D Sbjct: 431 FSKVSTYLPNHLSVRQGGSLLSYLRGLSIPQRSTSYAYLPVLCVIGLFL---WRSMRRRD 487 Query: 47 P*YTFSVDQVVKLYE 3 F QVVKLYE Sbjct: 488 NIIMFCGCQVVKLYE 502 >ref|XP_010036158.1| PREDICTED: pre-mRNA-processing factor 39 isoform X2 [Eucalyptus grandis] gi|702492195|ref|XP_010036159.1| PREDICTED: pre-mRNA-processing factor 39 isoform X2 [Eucalyptus grandis] Length = 823 Score = 59.7 bits (143), Expect = 8e-07 Identities = 37/75 (49%), Positives = 43/75 (57%) Frame = -2 Query: 227 FMQVCSYLPNHLSVRQGGSLLSYLRGLPVPPMEYSLCISPKFPLFVLFI*FCSFELELCD 48 F +V +YLPNHLSVRQGGSLLSYLRGL +P S P + LF+ + D Sbjct: 372 FSKVSTYLPNHLSVRQGGSLLSYLRGLSIPQRSTSYAYLPVLCVIGLFL---WRSMRRRD 428 Query: 47 P*YTFSVDQVVKLYE 3 F QVVKLYE Sbjct: 429 NIIMFCGCQVVKLYE 443 >ref|XP_010036157.1| PREDICTED: pre-mRNA-processing factor 39 isoform X1 [Eucalyptus grandis] Length = 882 Score = 59.7 bits (143), Expect = 8e-07 Identities = 37/75 (49%), Positives = 43/75 (57%) Frame = -2 Query: 227 FMQVCSYLPNHLSVRQGGSLLSYLRGLPVPPMEYSLCISPKFPLFVLFI*FCSFELELCD 48 F +V +YLPNHLSVRQGGSLLSYLRGL +P S P + LF+ + D Sbjct: 431 FSKVSTYLPNHLSVRQGGSLLSYLRGLSIPQRSTSYAYLPVLCVIGLFL---WRSMRRRD 487 Query: 47 P*YTFSVDQVVKLYE 3 F QVVKLYE Sbjct: 488 NIIMFCGCQVVKLYE 502 >emb|CDP03793.1| unnamed protein product [Coffea canephora] Length = 439 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 238 F*CYLCRCVLIFLTIYLSGKEGPSFPI*GASLFRQ 134 F CY CRCVLIFLTIYLSGK+GP F I GASLF++ Sbjct: 18 FQCYACRCVLIFLTIYLSGKDGPFFHIRGASLFQR 52