BLASTX nr result
ID: Cornus23_contig00017251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00017251 (294 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005650981.1| chlorophyll a/b-binding protein [Coccomyxa s... 65 1e-08 ref|XP_013904099.1| Chlorophyll a-b binding protein of LHCII typ... 64 6e-08 gb|ABD37899.1| light-harvesting chlorophyll-a/b binding protein ... 63 7e-08 gb|ACQ99368.1| chloroplast light-harvesting chlorophyll-a/b bind... 63 1e-07 ref|XP_001779229.1| predicted protein [Physcomitrella patens] gi... 63 1e-07 ref|XP_011397167.1| Chlorophyll a-b binding protein 3C, chloropl... 62 1e-07 ref|XP_005648382.1| hypothetical protein COCSUDRAFT_28488 [Cocco... 62 1e-07 ref|XP_005651417.1| chlorophyll a/b-binding protein [Coccomyxa s... 62 2e-07 dbj|BAA78594.1| hypothetical protein [Chlamydomonas sp. HS-5] 62 2e-07 ref|XP_002956352.1| hypothetical protein VOLCADRAFT_77072 [Volvo... 62 2e-07 ref|XP_001693987.1| light-harvesting protein of photosystem II [... 61 3e-07 ref|XP_013900342.1| Chlorophyll a-b binding protein of LHCII typ... 61 3e-07 ref|XP_013897717.1| Chlorophyll a-b binding protein of LHCII typ... 61 3e-07 ref|XP_001694115.1| chlorophyll a-b binding protein of LHCII [Ch... 61 3e-07 ref|XP_002949075.1| hypothetical protein VOLCADRAFT_80470 [Volvo... 61 3e-07 ref|XP_002951637.1| hypothetical protein VOLCADRAFT_109135 [Volv... 61 3e-07 ref|XP_002952704.1| light-harvesting chlorophyll a/b-binding pro... 61 3e-07 ref|XP_002952626.1| hypothetical protein VOLCADRAFT_81918 [Volvo... 61 3e-07 gb|ABD37910.1| light-harvesting chlorophyll-a/b binding protein ... 61 3e-07 gb|ABD37911.1| light-harvesting chlorophyll-a/b binding protein ... 61 3e-07 >ref|XP_005650981.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] gi|384252962|gb|EIE26437.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] Length = 245 Score = 65.5 bits (158), Expect = 1e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 100 EWYGPDRPGFLGPFTNPPDYLRGEFAGDYGWDT 2 E+YGPDR GFLGPFT P YL+GEF GDYGWDT Sbjct: 30 EFYGPDRAGFLGPFTESPSYLKGEFPGDYGWDT 62 >ref|XP_013904099.1| Chlorophyll a-b binding protein of LHCII typeI [Monoraphidium neglectum] gi|761975074|gb|KIZ05080.1| Chlorophyll a-b binding protein of LHCII typeI [Monoraphidium neglectum] Length = 249 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/34 (79%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = -3 Query: 100 EWYGPDRPGFLGPFTNP-PDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF PDYL GEF GDYGWDT Sbjct: 31 EWYGPDRPKFLGPFEGETPDYLTGEFPGDYGWDT 64 >gb|ABD37899.1| light-harvesting chlorophyll-a/b binding protein LhcbM2 [Acutodesmus obliquus] Length = 249 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEFAGDYGWDT Sbjct: 28 EWYGPDRPKFLGPFSEGDTPAYLTGEFAGDYGWDT 62 >gb|ACQ99368.1| chloroplast light-harvesting chlorophyll-a/b binding protein [Monoraphidium convolutum] Length = 248 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P+YL GEF GDYGWDT Sbjct: 27 EWYGPDRPKFLGPFSEGDTPEYLTGEFPGDYGWDT 61 >ref|XP_001779229.1| predicted protein [Physcomitrella patens] gi|162669328|gb|EDQ55917.1| predicted protein [Physcomitrella patens] Length = 266 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/33 (78%), Positives = 28/33 (84%), Gaps = 1/33 (3%) Frame = -3 Query: 97 WYGPDRPGFLGPFT-NPPDYLRGEFAGDYGWDT 2 WYGPDRP FLGPF+ N P YL+GEF GDYGWDT Sbjct: 48 WYGPDRPLFLGPFSGNTPSYLKGEFPGDYGWDT 80 >ref|XP_011397167.1| Chlorophyll a-b binding protein 3C, chloroplastic [Auxenochlorella protothecoides] gi|675351840|gb|KFM24280.1| Chlorophyll a-b binding protein 3C, chloroplastic [Auxenochlorella protothecoides] Length = 268 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 2/34 (5%) Frame = -3 Query: 97 WYGPDRPGFLGPFTN--PPDYLRGEFAGDYGWDT 2 WYGPDRP FLGPF++ P YL GEFAGDYGWDT Sbjct: 47 WYGPDRPKFLGPFSDGITPSYLNGEFAGDYGWDT 80 >ref|XP_005648382.1| hypothetical protein COCSUDRAFT_28488 [Coccomyxa subellipsoidea C-169] gi|384250359|gb|EIE23838.1| hypothetical protein COCSUDRAFT_28488 [Coccomyxa subellipsoidea C-169] Length = 275 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 97 WYGPDRPGFLGPFTNPPDYLRGEFAGDYGWDT 2 WYG DRPG+LG FT P YL GEF GDYGWDT Sbjct: 66 WYGADRPGYLGAFTRSPSYLNGEFPGDYGWDT 97 >ref|XP_005651417.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] gi|384253398|gb|EIE26873.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] Length = 250 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 100 EWYGPDRPGFLGPFTNPPDYLRGEFAGDYGWDT 2 E+YGPDR FLGPFT+ P YL GEF GDYGWDT Sbjct: 35 EFYGPDRATFLGPFTDTPSYLNGEFPGDYGWDT 67 >dbj|BAA78594.1| hypothetical protein [Chlamydomonas sp. HS-5] Length = 155 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = -3 Query: 100 EWYGPDRPGFLGPF-TNPPDYLRGEFAGDYGWDT 2 EWYGPDRP +LGPF N P YL GEF GDYGWDT Sbjct: 61 EWYGPDRPKWLGPFFQNTPSYLTGEFPGDYGWDT 94 >ref|XP_002956352.1| hypothetical protein VOLCADRAFT_77072 [Volvox carteri f. nagariensis] gi|300258258|gb|EFJ42496.1| hypothetical protein VOLCADRAFT_77072 [Volvox carteri f. nagariensis] Length = 250 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 31 EWYGPDRPKFLGPFSEGDVPSYLTGEFPGDYGWDT 65 >ref|XP_001693987.1| light-harvesting protein of photosystem II [Chlamydomonas reinhardtii] gi|15430556|dbj|BAB64413.1| light-harvesting chlorophyll-a/b binding protein LhcII-3 [Chlamydomonas reinhardtii] gi|15430564|dbj|BAB64417.1| light-harvesting chlorophyll-a/b binding protein LhcII-3 [Chlamydomonas reinhardtii] gi|158277154|gb|EDP02923.1| light-harvesting protein of photosystem II [Chlamydomonas reinhardtii] Length = 249 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 31 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 65 >ref|XP_013900342.1| Chlorophyll a-b binding protein of LHCII type I [Monoraphidium neglectum] gi|761970561|gb|KIZ01323.1| Chlorophyll a-b binding protein of LHCII type I [Monoraphidium neglectum] Length = 257 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 34 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 68 >ref|XP_013897717.1| Chlorophyll a-b binding protein of LHCII typeI [Monoraphidium neglectum] gi|761967158|gb|KIY98697.1| Chlorophyll a-b binding protein of LHCII typeI [Monoraphidium neglectum] Length = 258 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 35 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 69 >ref|XP_001694115.1| chlorophyll a-b binding protein of LHCII [Chlamydomonas reinhardtii] gi|12658406|gb|AAK01125.1|AF330793_1 light-harvesting complex II protein precursor [Chlamydomonas reinhardtii] gi|158277282|gb|EDP03051.1| chlorophyll a-b binding protein of LHCII [Chlamydomonas reinhardtii] Length = 249 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 31 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 65 >ref|XP_002949075.1| hypothetical protein VOLCADRAFT_80470 [Volvox carteri f. nagariensis] gi|300265820|gb|EFJ50010.1| hypothetical protein VOLCADRAFT_80470 [Volvox carteri f. nagariensis] Length = 252 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 33 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 67 >ref|XP_002951637.1| hypothetical protein VOLCADRAFT_109135 [Volvox carteri f. nagariensis] gi|300263246|gb|EFJ47448.1| hypothetical protein VOLCADRAFT_109135 [Volvox carteri f. nagariensis] Length = 251 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 32 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 66 >ref|XP_002952704.1| light-harvesting chlorophyll a/b-binding protein [Volvox carteri f. nagariensis] gi|300262048|gb|EFJ46257.1| light-harvesting chlorophyll a/b-binding protein [Volvox carteri f. nagariensis] Length = 251 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 32 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 66 >ref|XP_002952626.1| hypothetical protein VOLCADRAFT_81918 [Volvox carteri f. nagariensis] gi|300261970|gb|EFJ46179.1| hypothetical protein VOLCADRAFT_81918 [Volvox carteri f. nagariensis] Length = 251 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 32 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 66 >gb|ABD37910.1| light-harvesting chlorophyll-a/b binding protein LhcbM2a [Chlamydomonas incerta] Length = 246 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 28 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 62 >gb|ABD37911.1| light-harvesting chlorophyll-a/b binding protein LhcbM2b [Chlamydomonas incerta] Length = 229 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 100 EWYGPDRPGFLGPFT--NPPDYLRGEFAGDYGWDT 2 EWYGPDRP FLGPF+ + P YL GEF GDYGWDT Sbjct: 11 EWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDT 45