BLASTX nr result
ID: Cornus23_contig00017210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00017210 (390 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004294897.1| PREDICTED: probable galactinol--sucrose gala... 57 7e-06 >ref|XP_004294897.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 1 [Fragaria vesca subsp. vesca] Length = 756 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/55 (60%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = -3 Query: 160 VFLKYYFCEFLVVLE--IRRVIFFLLIVGDPDVEGSEGSHLVFVAAGSDPFDVIT 2 VFL +F VL+ R I L GDPDV+G EGSHLVFV AGSDPFDVIT Sbjct: 123 VFLPILEGDFRAVLQGNERNEIEICLESGDPDVDGFEGSHLVFVGAGSDPFDVIT 177