BLASTX nr result
ID: Cornus23_contig00017139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00017139 (358 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CRK38207.1| hypothetical protein BN1708_007672 [Verticillium... 138 1e-30 gb|KKY39397.1| putative 40s ribosomal protein s12 [Diaporthe amp... 138 1e-30 gb|KIN06229.1| hypothetical protein OIDMADRAFT_111959 [Oidiodend... 138 1e-30 gb|KFY71492.1| hypothetical protein V499_08326 [Pseudogymnoascus... 138 1e-30 gb|KFY45617.1| hypothetical protein V494_00871 [Pseudogymnoascus... 138 1e-30 gb|KFY24966.1| hypothetical protein V491_01953 [Pseudogymnoascus... 138 1e-30 gb|KFY17334.1| hypothetical protein V492_00744 [Pseudogymnoascus... 138 1e-30 gb|KFX91003.1| hypothetical protein V490_06138 [Pseudogymnoascus... 138 1e-30 gb|KFH49066.1| 40S ribosomal protein-like protein [Acremonium ch... 138 1e-30 gb|KEZ42540.1| hypothetical protein SAPIO_CDS5762 [Scedosporium ... 138 1e-30 gb|KEY71855.1| hypothetical protein S7711_05996 [Stachybotrys ch... 138 1e-30 ref|XP_003001146.1| 40S ribosomal protein S12 [Verticillium alfa... 138 1e-30 gb|ERS99887.1| 40S ribosomal protein S12 [Sporothrix schenckii A... 138 1e-30 gb|EQB51568.1| hypothetical protein CGLO_08877 [Colletotrichum g... 138 1e-30 ref|XP_008082880.1| L30e-like protein [Glarea lozoyensis ATCC 20... 138 1e-30 gb|EPE10168.1| 40s ribosomal protein s12 [Ophiostoma piceae UAMH... 138 1e-30 gb|ENH77920.1| 40s ribosomal protein s12 [Colletotrichum orbicul... 138 1e-30 ref|XP_012746225.1| small subunit ribosomal protein S12e [Pseudo... 138 1e-30 ref|XP_007274998.1| 40s ribosomal protein s12 [Colletotrichum gl... 138 1e-30 gb|EHK98371.1| putative 40S ribosomal protein S12 [Glarea lozoye... 138 1e-30 >emb|CRK38207.1| hypothetical protein BN1708_007672 [Verticillium longisporum] gi|913803650|emb|CRK07968.1| hypothetical protein BN1708_009779 [Verticillium longisporum] Length = 148 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 84 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 143 Query: 176 FETEQ 162 F+TEQ Sbjct: 144 FQTEQ 148 >gb|KKY39397.1| putative 40s ribosomal protein s12 [Diaporthe ampelina] Length = 148 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 84 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 143 Query: 176 FETEQ 162 F+TEQ Sbjct: 144 FQTEQ 148 >gb|KIN06229.1| hypothetical protein OIDMADRAFT_111959 [Oidiodendron maius Zn] Length = 169 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 105 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 164 Query: 176 FETEQ 162 F+TEQ Sbjct: 165 FQTEQ 169 >gb|KFY71492.1| hypothetical protein V499_08326 [Pseudogymnoascus pannorum VKM F-103] Length = 165 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 101 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 160 Query: 176 FETEQ 162 F+TEQ Sbjct: 161 FQTEQ 165 >gb|KFY45617.1| hypothetical protein V494_00871 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] Length = 255 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 191 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 250 Query: 176 FETEQ 162 F+TEQ Sbjct: 251 FQTEQ 255 >gb|KFY24966.1| hypothetical protein V491_01953 [Pseudogymnoascus pannorum VKM F-3775] gi|682374350|gb|KFY59088.1| hypothetical protein V496_05819 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682430880|gb|KFY96846.1| hypothetical protein V498_02439 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] gi|682436534|gb|KFZ01125.1| hypothetical protein V501_10195 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] gi|682438181|gb|KFZ02296.1| hypothetical protein V500_00292 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] gi|682453727|gb|KFZ12398.1| hypothetical protein V502_07091 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 148 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 84 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 143 Query: 176 FETEQ 162 F+TEQ Sbjct: 144 FQTEQ 148 >gb|KFY17334.1| hypothetical protein V492_00744 [Pseudogymnoascus pannorum VKM F-4246] Length = 148 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 84 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 143 Query: 176 FETEQ 162 F+TEQ Sbjct: 144 FQTEQ 148 >gb|KFX91003.1| hypothetical protein V490_06138 [Pseudogymnoascus pannorum VKM F-3557] gi|682281118|gb|KFY02293.1| hypothetical protein O988_02238 [Pseudogymnoascus pannorum VKM F-3808] gi|682323141|gb|KFY25520.1| hypothetical protein V493_04601 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] gi|682343936|gb|KFY37803.1| hypothetical protein V495_06941 [Pseudogymnoascus pannorum VKM F-4514 (FW-929)] gi|682368672|gb|KFY54402.1| hypothetical protein V497_07780 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] Length = 148 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 84 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 143 Query: 176 FETEQ 162 F+TEQ Sbjct: 144 FQTEQ 148 >gb|KFH49066.1| 40S ribosomal protein-like protein [Acremonium chrysogenum ATCC 11550] Length = 146 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 82 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 141 Query: 176 FETEQ 162 F+TEQ Sbjct: 142 FQTEQ 146 >gb|KEZ42540.1| hypothetical protein SAPIO_CDS5762 [Scedosporium apiospermum] Length = 177 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 113 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 172 Query: 176 FETEQ 162 F+TEQ Sbjct: 173 FQTEQ 177 >gb|KEY71855.1| hypothetical protein S7711_05996 [Stachybotrys chartarum IBT 7711] gi|667515055|gb|KFA45368.1| hypothetical protein S40293_09600 [Stachybotrys chartarum IBT 40293] gi|667727612|gb|KFA68844.1| hypothetical protein S40285_01162 [Stachybotrys chlorohalonata IBT 40285] gi|667743012|gb|KFA81463.1| hypothetical protein S40288_03329 [Stachybotrys chartarum IBT 40288] Length = 152 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 88 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 147 Query: 176 FETEQ 162 F+TEQ Sbjct: 148 FQTEQ 152 >ref|XP_003001146.1| 40S ribosomal protein S12 [Verticillium alfalfae VaMs.102] gi|261360404|gb|EEY22832.1| 40S ribosomal protein S12 [Verticillium alfalfae VaMs.102] Length = 145 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 81 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 140 Query: 176 FETEQ 162 F+TEQ Sbjct: 141 FQTEQ 145 >gb|ERS99887.1| 40S ribosomal protein S12 [Sporothrix schenckii ATCC 58251] gi|748541410|gb|KIH91715.1| small subunit ribosomal protein S12e [Sporothrix brasiliensis 5110] gi|780595056|gb|KJR85715.1| small subunit ribosomal protein S12e [Sporothrix schenckii 1099-18] Length = 158 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 94 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 153 Query: 176 FETEQ 162 F+TEQ Sbjct: 154 FQTEQ 158 >gb|EQB51568.1| hypothetical protein CGLO_08877 [Colletotrichum gloeosporioides Cg-14] Length = 121 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 57 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 116 Query: 176 FETEQ 162 F+TEQ Sbjct: 117 FQTEQ 121 >ref|XP_008082880.1| L30e-like protein [Glarea lozoyensis ATCC 20868] gi|512201373|gb|EPE30203.1| L30e-like protein [Glarea lozoyensis ATCC 20868] Length = 188 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 124 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 183 Query: 176 FETEQ 162 F+TEQ Sbjct: 184 FQTEQ 188 >gb|EPE10168.1| 40s ribosomal protein s12 [Ophiostoma piceae UAMH 11346] Length = 218 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 154 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 213 Query: 176 FETEQ 162 F+TEQ Sbjct: 214 FQTEQ 218 >gb|ENH77920.1| 40s ribosomal protein s12 [Colletotrichum orbiculare MAFF 240422] Length = 164 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 100 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 159 Query: 176 FETEQ 162 F+TEQ Sbjct: 160 FQTEQ 164 >ref|XP_012746225.1| small subunit ribosomal protein S12e [Pseudogymnoascus destructans 20631-21] gi|440636141|gb|ELR06060.1| small subunit ribosomal protein S12e [Pseudogymnoascus destructans 20631-21] Length = 148 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 84 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 143 Query: 176 FETEQ 162 F+TEQ Sbjct: 144 FQTEQ 148 >ref|XP_007274998.1| 40s ribosomal protein s12 [Colletotrichum gloeosporioides Nara gc5] gi|615462395|ref|XP_007598342.1| 40S ribosomal protein S12 [Colletotrichum fioriniae PJ7] gi|380481642|emb|CCF41723.1| 40S ribosomal protein S12 [Colletotrichum higginsianum] gi|429861243|gb|ELA35939.1| 40s ribosomal protein s12 [Colletotrichum gloeosporioides Nara gc5] gi|588896548|gb|EXF78002.1| 40S ribosomal protein S12 [Colletotrichum fioriniae PJ7] gi|640921138|gb|KDN65530.1| putative 40S ribosomal protein S12 [Colletotrichum sublineola] Length = 148 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 84 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 143 Query: 176 FETEQ 162 F+TEQ Sbjct: 144 FQTEQ 148 >gb|EHK98371.1| putative 40S ribosomal protein S12 [Glarea lozoyensis 74030] Length = 152 Score = 138 bits (348), Expect = 1e-30 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 356 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 177 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY Sbjct: 88 LCSEHKIPLIKVPDGKQLGEWAGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNY 147 Query: 176 FETEQ 162 F+TEQ Sbjct: 148 FQTEQ 152