BLASTX nr result
ID: Cornus23_contig00017104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00017104 (413 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514100.1| ATP binding protein, putative [Ricinus commu... 108 1e-21 ref|XP_011003352.1| PREDICTED: U-box domain-containing protein 3... 106 6e-21 ref|XP_011003351.1| PREDICTED: U-box domain-containing protein 3... 106 6e-21 ref|XP_002309208.2| hypothetical protein POPTR_0006s14900g [Popu... 106 6e-21 ref|XP_012076973.1| PREDICTED: U-box domain-containing protein 3... 101 3e-19 ref|XP_008242172.1| PREDICTED: U-box domain-containing protein 3... 100 7e-19 ref|XP_008242171.1| PREDICTED: U-box domain-containing protein 3... 100 7e-19 ref|XP_011460377.1| PREDICTED: U-box domain-containing protein 3... 99 1e-18 ref|XP_009604176.1| PREDICTED: U-box domain-containing protein 3... 99 1e-18 ref|XP_009604175.1| PREDICTED: U-box domain-containing protein 3... 99 1e-18 ref|XP_007012759.1| U-box domain-containing protein kinase famil... 99 1e-18 ref|XP_004287584.1| PREDICTED: U-box domain-containing protein 3... 99 1e-18 ref|XP_007204644.1| hypothetical protein PRUPE_ppa001685mg [Prun... 99 2e-18 ref|XP_014505470.1| PREDICTED: U-box domain-containing protein 3... 98 3e-18 gb|KOM47719.1| hypothetical protein LR48_Vigan07g142300 [Vigna a... 98 3e-18 ref|XP_006475494.1| PREDICTED: U-box domain-containing protein 3... 97 4e-18 ref|XP_006451528.1| hypothetical protein CICLE_v10007527mg [Citr... 97 4e-18 ref|XP_010656166.1| PREDICTED: U-box domain-containing protein 3... 97 6e-18 ref|XP_007154626.1| hypothetical protein PHAVU_003G134500g [Phas... 96 8e-18 ref|XP_010090090.1| U-box domain-containing protein 34 [Morus no... 96 1e-17 >ref|XP_002514100.1| ATP binding protein, putative [Ricinus communis] gi|223546556|gb|EEF48054.1| ATP binding protein, putative [Ricinus communis] Length = 778 Score = 108 bits (271), Expect = 1e-21 Identities = 52/60 (86%), Positives = 54/60 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCVQPQVP 232 DP+IAADGFTYEHRAIKAWL RH VSPVTKLRLQH+MLTPNHTLRSAIQ WRS V QVP Sbjct: 719 DPYIAADGFTYEHRAIKAWLGRHNVSPVTKLRLQHSMLTPNHTLRSAIQEWRSRVHFQVP 778 >ref|XP_011003352.1| PREDICTED: U-box domain-containing protein 34 isoform X2 [Populus euphratica] Length = 622 Score = 106 bits (265), Expect = 6e-21 Identities = 49/60 (81%), Positives = 54/60 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCVQPQVP 232 DP+IAADGFTYEHRAIKAWL+RH +SPVTKLR QH++LTPNHTLRSAIQ WRS V QVP Sbjct: 563 DPYIAADGFTYEHRAIKAWLDRHNISPVTKLRFQHSILTPNHTLRSAIQEWRSRVIMQVP 622 >ref|XP_011003351.1| PREDICTED: U-box domain-containing protein 34 isoform X1 [Populus euphratica] Length = 707 Score = 106 bits (265), Expect = 6e-21 Identities = 49/60 (81%), Positives = 54/60 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCVQPQVP 232 DP+IAADGFTYEHRAIKAWL+RH +SPVTKLR QH++LTPNHTLRSAIQ WRS V QVP Sbjct: 648 DPYIAADGFTYEHRAIKAWLDRHNISPVTKLRFQHSILTPNHTLRSAIQEWRSRVIMQVP 707 >ref|XP_002309208.2| hypothetical protein POPTR_0006s14900g [Populus trichocarpa] gi|550336370|gb|EEE92731.2| hypothetical protein POPTR_0006s14900g [Populus trichocarpa] Length = 707 Score = 106 bits (265), Expect = 6e-21 Identities = 49/60 (81%), Positives = 54/60 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCVQPQVP 232 DP+IAADGFTYEHRAIKAWL+RH +SPVTKLR QH++LTPNHTLRSAIQ WRS V QVP Sbjct: 648 DPYIAADGFTYEHRAIKAWLDRHNISPVTKLRFQHSILTPNHTLRSAIQEWRSRVIMQVP 707 >ref|XP_012076973.1| PREDICTED: U-box domain-containing protein 34 [Jatropha curcas] gi|643724665|gb|KDP33866.1| hypothetical protein JCGZ_07437 [Jatropha curcas] Length = 768 Score = 101 bits (251), Expect = 3e-19 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCVQPQVP 232 +P+IAADGFTYEHRAIKAWL+RH+VSPVTKLRLQH++L PN+TLRSAIQ WRS QVP Sbjct: 709 EPYIAADGFTYEHRAIKAWLDRHRVSPVTKLRLQHSILIPNNTLRSAIQEWRSRQHLQVP 768 >ref|XP_008242172.1| PREDICTED: U-box domain-containing protein 34 isoform X2 [Prunus mume] Length = 689 Score = 99.8 bits (247), Expect = 7e-19 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCV 247 DPHIAADGFTYE RAIKAWLE+H VSPVT+LRL+H++LTPNHTLRSAIQ WR+ V Sbjct: 630 DPHIAADGFTYEFRAIKAWLEKHNVSPVTRLRLEHSVLTPNHTLRSAIQEWRTHV 684 >ref|XP_008242171.1| PREDICTED: U-box domain-containing protein 34 isoform X1 [Prunus mume] Length = 759 Score = 99.8 bits (247), Expect = 7e-19 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCV 247 DPHIAADGFTYE RAIKAWLE+H VSPVT+LRL+H++LTPNHTLRSAIQ WR+ V Sbjct: 700 DPHIAADGFTYEFRAIKAWLEKHNVSPVTRLRLEHSVLTPNHTLRSAIQEWRTHV 754 >ref|XP_011460377.1| PREDICTED: U-box domain-containing protein 34 isoform X2 [Fragaria vesca subsp. vesca] Length = 683 Score = 99.4 bits (246), Expect = 1e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRS 253 DPHI+ADGFTYE+RAIKAWL++H VSPVT+LRLQH+ LTPNHTLRSAIQ WRS Sbjct: 627 DPHISADGFTYEYRAIKAWLDKHNVSPVTRLRLQHSELTPNHTLRSAIQEWRS 679 >ref|XP_009604176.1| PREDICTED: U-box domain-containing protein 34-like isoform X2 [Nicotiana tomentosiformis] Length = 668 Score = 99.4 bits (246), Expect = 1e-18 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRS 253 +PHIAADGFTYEHRAIKAW++RH VSPVTK RLQH MLTPNHTLR AIQ WRS Sbjct: 614 NPHIAADGFTYEHRAIKAWIDRHNVSPVTKQRLQHKMLTPNHTLRLAIQDWRS 666 >ref|XP_009604175.1| PREDICTED: U-box domain-containing protein 34-like isoform X1 [Nicotiana tomentosiformis] Length = 752 Score = 99.4 bits (246), Expect = 1e-18 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRS 253 +PHIAADGFTYEHRAIKAW++RH VSPVTK RLQH MLTPNHTLR AIQ WRS Sbjct: 698 NPHIAADGFTYEHRAIKAWIDRHNVSPVTKQRLQHKMLTPNHTLRLAIQDWRS 750 >ref|XP_007012759.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|590575697|ref|XP_007012760.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|508783122|gb|EOY30378.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|508783123|gb|EOY30379.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] Length = 752 Score = 99.4 bits (246), Expect = 1e-18 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCV 247 DPHIAADGFTYEHRAIKAWL++H VSPVTK RLQH++LTPN TLRSAIQ W+S V Sbjct: 693 DPHIAADGFTYEHRAIKAWLQKHNVSPVTKCRLQHSVLTPNQTLRSAIQEWKSRV 747 >ref|XP_004287584.1| PREDICTED: U-box domain-containing protein 34 isoform X1 [Fragaria vesca subsp. vesca] Length = 753 Score = 99.4 bits (246), Expect = 1e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRS 253 DPHI+ADGFTYE+RAIKAWL++H VSPVT+LRLQH+ LTPNHTLRSAIQ WRS Sbjct: 697 DPHISADGFTYEYRAIKAWLDKHNVSPVTRLRLQHSELTPNHTLRSAIQEWRS 749 >ref|XP_007204644.1| hypothetical protein PRUPE_ppa001685mg [Prunus persica] gi|462400175|gb|EMJ05843.1| hypothetical protein PRUPE_ppa001685mg [Prunus persica] Length = 780 Score = 98.6 bits (244), Expect = 2e-18 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCV 247 DPHIAADGFTYE RAIKAWLE+H VSPVT+LRL+H+ LTPNHTLRSAIQ WR+ V Sbjct: 721 DPHIAADGFTYEFRAIKAWLEKHNVSPVTRLRLKHSALTPNHTLRSAIQEWRTHV 775 >ref|XP_014505470.1| PREDICTED: U-box domain-containing protein 34 [Vigna radiata var. radiata] Length = 762 Score = 97.8 bits (242), Expect = 3e-18 Identities = 44/55 (80%), Positives = 51/55 (92%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCV 247 DP+IAADGFTYE+RAIKAWL RH VSP+TKL+LQH++LTPNHTLRSAIQ W+S V Sbjct: 706 DPYIAADGFTYEYRAIKAWLSRHNVSPMTKLKLQHSVLTPNHTLRSAIQEWKSGV 760 >gb|KOM47719.1| hypothetical protein LR48_Vigan07g142300 [Vigna angularis] Length = 762 Score = 97.8 bits (242), Expect = 3e-18 Identities = 44/55 (80%), Positives = 51/55 (92%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCV 247 DP+IAADGFTYE+RAIKAWL RH VSP+TKL+LQH++LTPNHTLRSAIQ W+S V Sbjct: 706 DPYIAADGFTYEYRAIKAWLSRHNVSPMTKLKLQHSVLTPNHTLRSAIQEWKSGV 760 >ref|XP_006475494.1| PREDICTED: U-box domain-containing protein 34-like [Citrus sinensis] Length = 769 Score = 97.4 bits (241), Expect = 4e-18 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCV 247 DP+IAADGFTYEHRAIKAWLE+H VSPVTKLRLQH + PN+TLRSAIQ WRS V Sbjct: 712 DPYIAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAIQQWRSPV 766 >ref|XP_006451528.1| hypothetical protein CICLE_v10007527mg [Citrus clementina] gi|557554754|gb|ESR64768.1| hypothetical protein CICLE_v10007527mg [Citrus clementina] Length = 769 Score = 97.4 bits (241), Expect = 4e-18 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCV 247 DP+IAADGFTYEHRAIKAWLE+H VSPVTKLRLQH + PN+TLRSAIQ WRS V Sbjct: 712 DPYIAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAIQQWRSPV 766 >ref|XP_010656166.1| PREDICTED: U-box domain-containing protein 34 [Vitis vinifera] gi|297738630|emb|CBI27875.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 96.7 bits (239), Expect = 6e-18 Identities = 45/56 (80%), Positives = 47/56 (83%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRSCVQ 244 DPHIAADGFTYEHRAIKAWL+RH VSPVTK QH MLTPN TLRSAIQ WR V+ Sbjct: 710 DPHIAADGFTYEHRAIKAWLDRHDVSPVTKWTFQHKMLTPNQTLRSAIQEWRCRVE 765 >ref|XP_007154626.1| hypothetical protein PHAVU_003G134500g [Phaseolus vulgaris] gi|561027980|gb|ESW26620.1| hypothetical protein PHAVU_003G134500g [Phaseolus vulgaris] Length = 763 Score = 96.3 bits (238), Expect = 8e-18 Identities = 42/53 (79%), Positives = 50/53 (94%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRS 253 DP+IAADGFTYE+RAIKAWL +H VSP+TKL+LQH++LTPNHTLRSAIQ W+S Sbjct: 707 DPYIAADGFTYEYRAIKAWLSKHNVSPMTKLKLQHSVLTPNHTLRSAIQEWKS 759 >ref|XP_010090090.1| U-box domain-containing protein 34 [Morus notabilis] gi|587848628|gb|EXB38887.1| U-box domain-containing protein 34 [Morus notabilis] Length = 768 Score = 95.9 bits (237), Expect = 1e-17 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -3 Query: 411 DPHIAADGFTYEHRAIKAWLERHKVSPVTKLRLQHTMLTPNHTLRSAIQVWRS 253 DPHIAADGFTYE+RAIKAWLE+H VSPVTK RLQH+MLT +HTLRSAI WRS Sbjct: 712 DPHIAADGFTYEYRAIKAWLEKHSVSPVTKRRLQHSMLTTDHTLRSAINDWRS 764