BLASTX nr result
ID: Cornus23_contig00016859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00016859 (332 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098575.1| hypothetical protein L484_026017 [Morus nota... 84 5e-14 ref|XP_010655735.1| PREDICTED: serine/threonine-protein phosphat... 72 2e-10 ref|XP_011096673.1| PREDICTED: serine/threonine-protein phosphat... 69 2e-09 ref|XP_010241190.1| PREDICTED: serine/threonine-protein phosphat... 69 2e-09 ref|XP_012075635.1| PREDICTED: serine/threonine-protein phosphat... 69 2e-09 ref|XP_002523200.1| conserved hypothetical protein [Ricinus comm... 69 2e-09 ref|XP_012569868.1| PREDICTED: serine/threonine-protein phosphat... 67 4e-09 ref|XP_012569866.1| PREDICTED: serine/threonine-protein phosphat... 67 4e-09 gb|KHN22994.1| Serine/threonine-protein phosphatase 6 regulatory... 67 4e-09 ref|XP_009362241.1| PREDICTED: serine/threonine-protein phosphat... 67 4e-09 emb|CDP05604.1| unnamed protein product [Coffea canephora] 67 4e-09 ref|XP_008439556.1| PREDICTED: serine/threonine-protein phosphat... 67 4e-09 ref|XP_008372228.1| PREDICTED: serine/threonine-protein phosphat... 67 4e-09 ref|XP_008225588.1| PREDICTED: serine/threonine-protein phosphat... 67 4e-09 gb|KDO75284.1| hypothetical protein CISIN_1g0034112mg, partial [... 67 4e-09 gb|KDO75283.1| hypothetical protein CISIN_1g0034112mg [Citrus si... 67 4e-09 ref|XP_012827513.1| PREDICTED: serine/threonine-protein phosphat... 67 4e-09 ref|XP_006468292.1| PREDICTED: serine/threonine-protein phosphat... 67 4e-09 ref|XP_006448922.1| hypothetical protein CICLE_v10014271mg [Citr... 67 4e-09 ref|XP_006448920.1| hypothetical protein CICLE_v10014271mg [Citr... 67 4e-09 >ref|XP_010098575.1| hypothetical protein L484_026017 [Morus notabilis] gi|587886430|gb|EXB75235.1| hypothetical protein L484_026017 [Morus notabilis] Length = 933 Score = 83.6 bits (205), Expect = 5e-14 Identities = 41/54 (75%), Positives = 45/54 (83%) Frame = -2 Query: 163 FCVDRSEFESFAGGHFAVRFKMFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 FC RSE+ S GG+F F MFWRMAGL+TASPVETILDK+NFTLEELLDEDE Sbjct: 137 FC--RSEYSSACGGNFFEEFNMFWRMAGLSTASPVETILDKDNFTLEELLDEDE 188 >ref|XP_010655735.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 2 [Vitis vinifera] Length = 871 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 118 FAVRFKMFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 F +F MFWRMAGL+TASPVETILDKENFTLEELLDEDE Sbjct: 76 FVDQFTMFWRMAGLSTASPVETILDKENFTLEELLDEDE 114 >ref|XP_011096673.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3 [Sesamum indicum] Length = 790 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLEELLDEDE 33 >ref|XP_010241190.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 2 [Nelumbo nucifera] Length = 786 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLEELLDEDE 33 >ref|XP_012075635.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 2 [Jatropha curcas] gi|643726133|gb|KDP34941.1| hypothetical protein JCGZ_09229 [Jatropha curcas] Length = 786 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLEELLDEDE 33 >ref|XP_002523200.1| conserved hypothetical protein [Ricinus communis] gi|223537607|gb|EEF39231.1| conserved hypothetical protein [Ricinus communis] Length = 783 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLEELLDEDE 33 >ref|XP_012569868.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3 isoform X2 [Cicer arietinum] Length = 758 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILD+ENFTLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDRENFTLEELLDEDE 33 >ref|XP_012569866.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3 isoform X1 [Cicer arietinum] Length = 759 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILD+ENFTLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDRENFTLEELLDEDE 33 >gb|KHN22994.1| Serine/threonine-protein phosphatase 6 regulatory subunit 3 [Glycine soja] Length = 881 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTL+ELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLDELLDEDE 33 >ref|XP_009362241.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like [Pyrus x bretschneideri] Length = 778 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDK+NFTLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKDNFTLEELLDEDE 33 >emb|CDP05604.1| unnamed protein product [Coffea canephora] Length = 784 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKEN+TLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKENYTLEELLDEDE 33 >ref|XP_008439556.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 2 [Cucumis melo] Length = 772 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTL+ELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLDELLDEDE 33 >ref|XP_008372228.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like [Malus domestica] Length = 776 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDK+NFTLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKDNFTLEELLDEDE 33 >ref|XP_008225588.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3 [Prunus mume] Length = 775 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDK+NFTLEELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKDNFTLEELLDEDE 33 >gb|KDO75284.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis] gi|641856519|gb|KDO75285.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis] gi|641856520|gb|KDO75286.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis] gi|641856521|gb|KDO75287.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis] gi|641856522|gb|KDO75288.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis] Length = 551 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTLEELLDED+ Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLEELLDEDD 33 >gb|KDO75283.1| hypothetical protein CISIN_1g0034112mg [Citrus sinensis] Length = 560 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTLEELLDED+ Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLEELLDEDD 33 >ref|XP_012827513.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like [Erythranthe guttatus] gi|848927542|ref|XP_012827514.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like [Erythranthe guttatus] gi|604299194|gb|EYU19129.1| hypothetical protein MIMGU_mgv1a001633mg [Erythranthe guttata] Length = 781 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTL+ELLDEDE Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLDELLDEDE 33 >ref|XP_006468292.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like isoform X1 [Citrus sinensis] gi|568827917|ref|XP_006468293.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like isoform X2 [Citrus sinensis] gi|568827919|ref|XP_006468294.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like isoform X3 [Citrus sinensis] Length = 813 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTLEELLDED+ Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLEELLDEDD 33 >ref|XP_006448922.1| hypothetical protein CICLE_v10014271mg [Citrus clementina] gi|557551533|gb|ESR62162.1| hypothetical protein CICLE_v10014271mg [Citrus clementina] Length = 831 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTLEELLDED+ Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLEELLDEDD 33 >ref|XP_006448920.1| hypothetical protein CICLE_v10014271mg [Citrus clementina] gi|567913215|ref|XP_006448921.1| hypothetical protein CICLE_v10014271mg [Citrus clementina] gi|557551531|gb|ESR62160.1| hypothetical protein CICLE_v10014271mg [Citrus clementina] gi|557551532|gb|ESR62161.1| hypothetical protein CICLE_v10014271mg [Citrus clementina] Length = 822 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 MFWRMAGLTTASPVETILDKENFTLEELLDEDE 2 MFWRMAGL+TASPVETILDKENFTLEELLDED+ Sbjct: 1 MFWRMAGLSTASPVETILDKENFTLEELLDEDD 33