BLASTX nr result
ID: Cornus23_contig00016638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00016638 (616 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010312252.1| PREDICTED: acyltransferase-like protein At1g... 87 5e-15 ref|XP_010312251.1| PREDICTED: acyltransferase-like protein At1g... 87 5e-15 ref|XP_004230141.1| PREDICTED: acyltransferase-like protein At1g... 87 5e-15 ref|XP_009610645.1| PREDICTED: acyltransferase-like protein At1g... 87 9e-15 ref|XP_009610644.1| PREDICTED: acyltransferase-like protein At1g... 87 9e-15 ref|XP_012835469.1| PREDICTED: acyltransferase-like protein At1g... 87 9e-15 emb|CDP08607.1| unnamed protein product [Coffea canephora] 85 3e-14 ref|XP_006347827.1| PREDICTED: acyltransferase-like protein At1g... 84 6e-14 ref|XP_009776531.1| PREDICTED: acyltransferase-like protein At1g... 82 2e-13 ref|XP_009776530.1| PREDICTED: acyltransferase-like protein At1g... 82 2e-13 ref|XP_009609701.1| PREDICTED: acyltransferase-like protein At1g... 82 2e-13 ref|XP_009609700.1| PREDICTED: acyltransferase-like protein At1g... 82 2e-13 ref|XP_010025089.1| PREDICTED: acyltransferase-like protein At1g... 81 5e-13 ref|XP_010025090.1| PREDICTED: acyltransferase-like protein At1g... 81 5e-13 gb|KCW61677.1| hypothetical protein EUGRSUZ_H04410 [Eucalyptus g... 81 5e-13 ref|XP_010025091.1| PREDICTED: acyltransferase-like protein At1g... 80 7e-13 ref|XP_010904775.1| PREDICTED: acyltransferase-like protein At1g... 80 9e-13 ref|XP_011003814.1| PREDICTED: acyltransferase-like protein At1g... 79 2e-12 emb|CBI34239.3| unnamed protein product [Vitis vinifera] 79 2e-12 ref|XP_002271452.2| PREDICTED: acyltransferase-like protein At1g... 79 2e-12 >ref|XP_010312252.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X3 [Solanum lycopersicum] Length = 573 Score = 87.4 bits (215), Expect = 5e-15 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLERN 450 RYFKDNGHTILLE+G+NLL+IIK+TS Y S+RRDYV DFLPPS SEFK ++ N Sbjct: 225 RYFKDNGHTILLEDGINLLSIIKATSKYRRSKRRDYVKDFLPPSKSEFKNAIKNN 279 >ref|XP_010312251.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X2 [Solanum lycopersicum] Length = 682 Score = 87.4 bits (215), Expect = 5e-15 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLERN 450 RYFKDNGHTILLE+G+NLL+IIK+TS Y S+RRDYV DFLPPS SEFK ++ N Sbjct: 334 RYFKDNGHTILLEDGINLLSIIKATSKYRRSKRRDYVKDFLPPSKSEFKNAIKNN 388 >ref|XP_004230141.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X1 [Solanum lycopersicum] Length = 712 Score = 87.4 bits (215), Expect = 5e-15 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLERN 450 RYFKDNGHTILLE+G+NLL+IIK+TS Y S+RRDYV DFLPPS SEFK ++ N Sbjct: 364 RYFKDNGHTILLEDGINLLSIIKATSKYRRSKRRDYVKDFLPPSKSEFKNAIKNN 418 >ref|XP_009610645.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 541 Score = 86.7 bits (213), Expect = 9e-15 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLERNR 447 R+FKDNGHTILLE+G+NLL+IIK T Y SRR DYV+DFLPPS SEFK+ ++ NR Sbjct: 356 RHFKDNGHTILLEDGINLLSIIKGTGKYRHSRRHDYVMDFLPPSMSEFKKAIDNNR 411 >ref|XP_009610644.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X1 [Nicotiana tomentosiformis] Length = 704 Score = 86.7 bits (213), Expect = 9e-15 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLERNR 447 R+FKDNGHTILLE+G+NLL+IIK T Y SRR DYV+DFLPPS SEFK+ ++ NR Sbjct: 356 RHFKDNGHTILLEDGINLLSIIKGTGKYRHSRRHDYVMDFLPPSMSEFKKAIDNNR 411 >ref|XP_012835469.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic [Erythranthe guttatus] gi|604335001|gb|EYU38979.1| hypothetical protein MIMGU_mgv1a002068mg [Erythranthe guttata] Length = 719 Score = 86.7 bits (213), Expect = 9e-15 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLERNR 447 RYFKDNGHTILLE+GVNLLT IK T Y S +RDYV+DF+PPS SEFK+ L++N+ Sbjct: 372 RYFKDNGHTILLEDGVNLLTYIKCTCTYRRSSKRDYVMDFIPPSASEFKQTLQQNK 427 >emb|CDP08607.1| unnamed protein product [Coffea canephora] Length = 608 Score = 85.1 bits (209), Expect = 3e-14 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLERNR 447 +YFKDNGH ILLE+GVNLLT+IK T Y SR+RD V+DFLPPS SEFK+ LE N+ Sbjct: 263 KYFKDNGHAILLEDGVNLLTVIKGTFKYRQSRKRDVVMDFLPPSDSEFKQALESNK 318 >ref|XP_006347827.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like [Solanum tuberosum] Length = 712 Score = 84.0 bits (206), Expect = 6e-14 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLERN 450 RYFKDNGHTILLE+G+NLL+IIK+T Y S+R DYV+DFLPPS SEFK+ + N Sbjct: 364 RYFKDNGHTILLEDGINLLSIIKATGKYRRSKRHDYVMDFLPPSKSEFKKTTKDN 418 >ref|XP_009776531.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X2 [Nicotiana sylvestris] Length = 573 Score = 82.4 bits (202), Expect = 2e-13 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLE 456 RYFKDNGH ILLE+G+NLL+IIK TS Y S+R DYV+DFLPPS SEFK+ ++ Sbjct: 225 RYFKDNGHAILLEDGINLLSIIKGTSKYRHSKRHDYVMDFLPPSMSEFKKAVQ 277 >ref|XP_009776530.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X1 [Nicotiana sylvestris] Length = 712 Score = 82.4 bits (202), Expect = 2e-13 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLE 456 RYFKDNGH ILLE+G+NLL+IIK TS Y S+R DYV+DFLPPS SEFK+ ++ Sbjct: 364 RYFKDNGHAILLEDGINLLSIIKGTSKYRHSKRHDYVMDFLPPSMSEFKKAVQ 416 >ref|XP_009609701.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 573 Score = 82.4 bits (202), Expect = 2e-13 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLE 456 RYFKDNGH ILLE+G+NLL+IIK TS Y S+R DYV+DFLPPS SEFK+ ++ Sbjct: 225 RYFKDNGHAILLEDGINLLSIIKGTSKYRHSKRHDYVMDFLPPSMSEFKKAVQ 277 >ref|XP_009609700.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X1 [Nicotiana tomentosiformis] Length = 712 Score = 82.4 bits (202), Expect = 2e-13 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLE 456 RYFKDNGH ILLE+G+NLL+IIK TS Y S+R DYV+DFLPPS SEFK+ ++ Sbjct: 364 RYFKDNGHAILLEDGINLLSIIKGTSKYRHSKRHDYVMDFLPPSMSEFKKAVQ 416 >ref|XP_010025089.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X1 [Eucalyptus grandis] Length = 706 Score = 80.9 bits (198), Expect = 5e-13 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFK 468 RYFKDNGHT+LLE+G+NLLTIIK T Y RR DYV+DFLPPS SE+K Sbjct: 368 RYFKDNGHTLLLEDGINLLTIIKGTHTYRRRRRHDYVLDFLPPSMSEYK 416 >ref|XP_010025090.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic isoform X2 [Eucalyptus grandis] gi|629095683|gb|KCW61678.1| hypothetical protein EUGRSUZ_H04410 [Eucalyptus grandis] Length = 655 Score = 80.9 bits (198), Expect = 5e-13 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFK 468 RYFKDNGHT+LLE+G+NLLTIIK T Y RR DYV+DFLPPS SE+K Sbjct: 317 RYFKDNGHTLLLEDGINLLTIIKGTHTYRRRRRHDYVLDFLPPSMSEYK 365 >gb|KCW61677.1| hypothetical protein EUGRSUZ_H04410 [Eucalyptus grandis] Length = 573 Score = 80.9 bits (198), Expect = 5e-13 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFK 468 RYFKDNGHT+LLE+G+NLLTIIK T Y RR DYV+DFLPPS SE+K Sbjct: 235 RYFKDNGHTLLLEDGINLLTIIKGTHTYRRRRRHDYVLDFLPPSMSEYK 283 >ref|XP_010025091.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic [Eucalyptus grandis] gi|629095681|gb|KCW61676.1| hypothetical protein EUGRSUZ_H04409 [Eucalyptus grandis] Length = 714 Score = 80.5 bits (197), Expect = 7e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFK 468 RYFKDNGHT+LLE+G+NLLT+IK T Y RR DYV+DFLPPS SE+K Sbjct: 369 RYFKDNGHTLLLEDGINLLTVIKGTHTYRRRRRHDYVLDFLPPSMSEYK 417 >ref|XP_010904775.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic [Elaeis guineensis] Length = 518 Score = 80.1 bits (196), Expect = 9e-13 Identities = 34/55 (61%), Positives = 46/55 (83%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLERN 450 RYFKDNGHT+LLE+G+NLLTIIK +YH S + DYV D+LPP+ SE+K+ +E++ Sbjct: 175 RYFKDNGHTLLLEDGINLLTIIKGACIYHHSGQHDYVTDYLPPTHSEYKKHIEQD 229 >ref|XP_011003814.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic [Populus euphratica] Length = 707 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKE 465 RYFKDNGH ILLE+GVNLLT+IK T Y SRR D V+DF+PPS SEFK+ Sbjct: 361 RYFKDNGHNILLEDGVNLLTVIKGTGKYRRSRRIDLVLDFIPPSMSEFKQ 410 >emb|CBI34239.3| unnamed protein product [Vitis vinifera] Length = 602 Score = 79.0 bits (193), Expect = 2e-12 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLER 453 RYFKDNGHT+LLE+GVNLLTIIK Y SRR DYV DFLPPS SE K ++ Sbjct: 257 RYFKDNGHTLLLEDGVNLLTIIKGALRYRRSRRHDYVSDFLPPSMSELKRAFDQ 310 >ref|XP_002271452.2| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic [Vitis vinifera] gi|731416599|ref|XP_010659957.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic [Vitis vinifera] Length = 711 Score = 79.0 bits (193), Expect = 2e-12 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -3 Query: 614 RYFKDNGHTILLEEGVNLLTIIKSTSMYHLSRRRDYVIDFLPPSTSEFKERLER 453 RYFKDNGHT+LLE+GVNLLTIIK Y SRR DYV DFLPPS SE K ++ Sbjct: 366 RYFKDNGHTLLLEDGVNLLTIIKGALRYRRSRRHDYVSDFLPPSMSELKRAFDQ 419