BLASTX nr result
ID: Cornus23_contig00016271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00016271 (649 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21459.3| unnamed protein product [Vitis vinifera] 74 9e-11 gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlise... 71 5e-10 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 57 7e-06 >emb|CBI21459.3| unnamed protein product [Vitis vinifera] Length = 79 Score = 73.6 bits (179), Expect = 9e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 24 LLGKTDQTDYYQNDTNCFKDPTCIFFALGSFIN 122 LLGKTDQTDYYQND NCFKDPTCIFFALGSFIN Sbjct: 47 LLGKTDQTDYYQNDLNCFKDPTCIFFALGSFIN 79 >gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlisea aurea] Length = 88 Score = 71.2 bits (173), Expect = 5e-10 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 3/75 (4%) Frame = +2 Query: 419 VFTLSISQINDG--FCLTTKRAPESDRTICQAIVLLFPQSYGVRHRFLNKIN-SFDCMMD 589 VFT ISQI DG FC S+RT ++LLF QSYGVRHR ++I+ F+ MM+ Sbjct: 17 VFTFQISQIVDGVYFCFG-----HSNRTK-PFVMLLFSQSYGVRHRLQDQISIDFEWMME 70 Query: 590 SPEKHWRACKRGALP 634 SPEK WRACKRGALP Sbjct: 71 SPEKPWRACKRGALP 85 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 57.4 bits (137), Expect = 7e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 24 LLGKTDQTDYYQNDTNCFKDPTCIF 98 LLGKTDQTDYY+ND+NCFKDPTCIF Sbjct: 16 LLGKTDQTDYYRNDSNCFKDPTCIF 40