BLASTX nr result
ID: Cornus23_contig00016112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00016112 (254 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE08430.1| scp-like extracellular protein [Ophiostoma piceae... 69 1e-09 ref|XP_003010963.1| SCP-like extracellular protein, putative [Ar... 68 3e-09 ref|XP_013944059.1| hypothetical protein TRIATDRAFT_299424 [Tric... 68 3e-09 ref|XP_007297217.1| scp-like extracellular protein [Marssonina b... 67 5e-09 ref|XP_001222832.1| hypothetical protein CHGG_06737 [Chaetomium ... 67 7e-09 gb|KJX92411.1| PR-1-like protein [Zymoseptoria brevis] 66 9e-09 gb|EME47364.1| hypothetical protein DOTSEDRAFT_69335 [Dothistrom... 66 9e-09 gb|KJY00125.1| scp-like extracellular protein [Zymoseptoria brevis] 66 1e-08 ref|XP_003851988.1| hypothetical protein MYCGRDRAFT_109710 [Zymo... 66 1e-08 ref|XP_002585263.1| conserved hypothetical protein [Uncinocarpus... 66 1e-08 gb|KMU86214.1| hypothetical protein CIHG_04002 [Coccidioides imm... 65 2e-08 gb|KMP04065.1| hypothetical protein CIRG_03756 [Coccidioides imm... 65 2e-08 gb|KDB27711.1| hypothetical protein H109_00505 [Trichophyton int... 65 2e-08 gb|EEH17953.1| hypothetical protein PABG_00516 [Paracoccidioides... 65 2e-08 gb|EZF28557.1| hypothetical protein H101_07763 [Trichophyton int... 65 2e-08 ref|XP_006691616.1| SCP / tpx-1 / ag5 / PR-1 / sc7 family of ext... 65 2e-08 gb|EGD98303.1| hypothetical protein TESG_05682 [Trichophyton ton... 65 2e-08 ref|XP_003070100.1| SCP-like extracellular family protein [Cocci... 65 2e-08 ref|XP_010758658.1| hypothetical protein PADG_02932 [Paracoccidi... 65 2e-08 ref|XP_002794512.1| conserved hypothetical protein [Paracoccidio... 65 2e-08 >gb|EPE08430.1| scp-like extracellular protein [Ophiostoma piceae UAMH 11346] Length = 347 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -2 Query: 196 TDYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 TDY S +Y HN+HR+NHSAPA WD L S A TVA SC Y HD+T Sbjct: 175 TDYSSTAIYHHNIHRSNHSAPAASWDSALASYAATVASSCVYGHDLT 221 >ref|XP_003010963.1| SCP-like extracellular protein, putative [Arthroderma benhamiae CBS 112371] gi|291174509|gb|EFE30323.1| SCP-like extracellular protein, putative [Arthroderma benhamiae CBS 112371] Length = 414 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 DYK Y HN+HR+NHSAPAL W LES A+ +AESCNY HD + Sbjct: 149 DYKEVAGYHHNVHRSNHSAPALTWSSALESSARKLAESCNYGHDTS 194 >ref|XP_013944059.1| hypothetical protein TRIATDRAFT_299424 [Trichoderma atroviride IMI 206040] gi|358396444|gb|EHK45825.1| hypothetical protein TRIATDRAFT_299424 [Trichoderma atroviride IMI 206040] Length = 344 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 DY+SA++ HN+HRANHSAPALEWDD+L A+ A C +AHD+T Sbjct: 174 DYQSAMLNEHNIHRANHSAPALEWDDQLAGFAQITASGCVFAHDMT 219 >ref|XP_007297217.1| scp-like extracellular protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859396|gb|EKD12462.1| scp-like extracellular protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 389 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -2 Query: 196 TDYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDV 59 TDYKSA +Y HN HRANHSA LEWDD L S A+T+A +C + HD+ Sbjct: 218 TDYKSAALYHHNKHRANHSADPLEWDDTLASYAQTIAYNCVFEHDM 263 >ref|XP_001222832.1| hypothetical protein CHGG_06737 [Chaetomium globosum CBS 148.51] gi|88182650|gb|EAQ90118.1| hypothetical protein CHGG_06737 [Chaetomium globosum CBS 148.51] Length = 319 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -2 Query: 196 TDYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHD 62 +DY S VY HN+HR NHSA ALEWDDE+ AKT+AE C + HD Sbjct: 147 SDYSSTAVYHHNIHRFNHSASALEWDDEIAGYAKTLAERCVFEHD 191 >gb|KJX92411.1| PR-1-like protein [Zymoseptoria brevis] Length = 200 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 190 YKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 YK AV+Y HNLHRANHS+PAL WD LE+ A+ A++C Y H+ T Sbjct: 33 YKDAVLYHHNLHRANHSSPALVWDTNLETIARNTAKTCQYKHNTT 77 >gb|EME47364.1| hypothetical protein DOTSEDRAFT_69335 [Dothistroma septosporum NZE10] Length = 280 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/65 (50%), Positives = 38/65 (58%) Frame = -2 Query: 196 TDYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVTXXXXXXXXXXXXG 17 TDY VY HNLHRANHS + WDD L S A+T+AESC YAH+V G Sbjct: 111 TDYAGKCVYHHNLHRANHSVSDIAWDDGLASIAQTIAESCVYAHNVQEGGGGYGQNIAAG 170 Query: 16 VEQAN 2 V+ AN Sbjct: 171 VDAAN 175 >gb|KJY00125.1| scp-like extracellular protein [Zymoseptoria brevis] Length = 286 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 196 TDYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDV 59 TDYKS VVY HN+ R+NHS +EWD+ L +CAK +A SC YAH+V Sbjct: 119 TDYKSKVVYFHNMVRSNHSCSTVEWDEGLYNCAKEIASSCVYAHNV 164 >ref|XP_003851988.1| hypothetical protein MYCGRDRAFT_109710 [Zymoseptoria tritici IPO323] gi|339471868|gb|EGP86964.1| hypothetical protein MYCGRDRAFT_109710 [Zymoseptoria tritici IPO323] Length = 200 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 190 YKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 YK AV+Y HNLHRANHS+PAL WD LE+ A+ A++C Y H+ T Sbjct: 33 YKDAVLYHHNLHRANHSSPALVWDTNLETIARDTAKTCQYKHNTT 77 >ref|XP_002585263.1| conserved hypothetical protein [Uncinocarpus reesii 1704] gi|237906709|gb|EEP81110.1| conserved hypothetical protein [Uncinocarpus reesii 1704] Length = 302 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHD 62 DY+ V+Y HN+HR+NHSAPALEW +LES A+ +AE+C Y H+ Sbjct: 138 DYRGVVLYHHNVHRSNHSAPALEWSTDLESSARQLAETCVYGHN 181 >gb|KMU86214.1| hypothetical protein CIHG_04002 [Coccidioides immitis H538.4] Length = 293 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHD 62 DYK V+Y HN+HR+NHSA AL WDD LES AK +A++C Y H+ Sbjct: 129 DYKGVVLYHHNVHRSNHSAEALTWDDNLESSAKQLADTCVYEHN 172 >gb|KMP04065.1| hypothetical protein CIRG_03756 [Coccidioides immitis RMSCC 2394] Length = 320 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHD 62 DYK V+Y HN+HR+NHSA AL WDD LES AK +A++C Y H+ Sbjct: 156 DYKGVVLYHHNVHRSNHSAEALTWDDNLESSAKQLADTCVYEHN 199 >gb|KDB27711.1| hypothetical protein H109_00505 [Trichophyton interdigitale MR816] Length = 303 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 DYK Y HN+HR+NHSAPAL W LES AK +AESC Y HD + Sbjct: 143 DYKEQTNYHHNVHRSNHSAPALSWSSALESSAKKLAESCVYGHDTS 188 >gb|EEH17953.1| hypothetical protein PABG_00516 [Paracoccidioides brasiliensis Pb03] Length = 271 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 196 TDYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 TDYKS V+ HN+HRANHSAP+L W D +ES A T+A C + HDV+ Sbjct: 115 TDYKSLVLKHHNIHRANHSAPSLTWSDNMESYALTLANRCVFEHDVS 161 >gb|EZF28557.1| hypothetical protein H101_07763 [Trichophyton interdigitale H6] Length = 303 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 DYK Y HN+HR+NHSAPAL W LES AK +AESC Y HD + Sbjct: 143 DYKEQTNYHHNVHRSNHSAPALSWSSALESSAKKLAESCVYGHDTS 188 >ref|XP_006691616.1| SCP / tpx-1 / ag5 / PR-1 / sc7 family of extracellular domain-containing protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340975509|gb|EGS22624.1| SCP / tpx-1 / ag5 / PR-1 / sc7 family of extracellular domain-containing protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 328 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 +YK +Y HN+HR NHSA ALEWDD L S A+T+A+ C + HDVT Sbjct: 159 EYKETALYHHNVHRFNHSAAALEWDDTLASYAETLAKRCKFGHDVT 204 >gb|EGD98303.1| hypothetical protein TESG_05682 [Trichophyton tonsurans CBS 112818] Length = 303 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 DYK Y HN+HR+NHSAPAL W LES AK +AESC Y HD + Sbjct: 143 DYKEQTDYHHNVHRSNHSAPALSWSSALESSAKKLAESCVYGHDTS 188 >ref|XP_003070100.1| SCP-like extracellular family protein [Coccidioides posadasii C735 delta SOWgp] gi|240109786|gb|EER27955.1| SCP-like extracellular family protein [Coccidioides posadasii C735 delta SOWgp] gi|320031947|gb|EFW13904.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|855532798|gb|KMM67945.1| hypothetical protein CPAG_04278 [Coccidioides posadasii RMSCC 3488] Length = 306 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -2 Query: 193 DYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHD 62 DYK V+Y HN+HR+NHSA AL WDD LES AK +A++C Y H+ Sbjct: 142 DYKGVVLYHHNVHRSNHSAEALTWDDNLESSAKQLADTCVYEHN 185 >ref|XP_010758658.1| hypothetical protein PADG_02932 [Paracoccidioides brasiliensis Pb18] gi|226291406|gb|EEH46834.1| hypothetical protein PADG_02932 [Paracoccidioides brasiliensis Pb18] Length = 271 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 196 TDYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 TDYKS V+ HN+HRANHSAP+L W D +ES A T+A C + HDV+ Sbjct: 115 TDYKSLVLKHHNIHRANHSAPSLTWSDNMESYALTLANRCVFEHDVS 161 >ref|XP_002794512.1| conserved hypothetical protein [Paracoccidioides lutzii Pb01] gi|226285928|gb|EEH41494.1| hypothetical protein PAAG_03057 [Paracoccidioides lutzii Pb01] Length = 264 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 196 TDYKSAVVYSHNLHRANHSAPALEWDDELESCAKTVAESCNYAHDVT 56 TDYKS V+ HN+HRANHSAP+L W D +ES A T+A C + HDV+ Sbjct: 108 TDYKSLVLKHHNIHRANHSAPSLTWSDSMESYALTLANRCVFKHDVS 154