BLASTX nr result
ID: Cornus23_contig00016060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00016060 (303 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010247599.1| PREDICTED: protein LURP-one-related 12-like ... 72 1e-10 ref|XP_010247598.1| PREDICTED: protein LURP-one-related 12-like ... 72 1e-10 ref|XP_010247597.1| PREDICTED: protein LURP-one-related 12-like ... 72 1e-10 ref|XP_012073172.1| PREDICTED: protein LURP-one-related 5 [Jatro... 69 1e-09 ref|XP_010097226.1| hypothetical protein L484_025775 [Morus nota... 68 2e-09 ref|XP_008228691.1| PREDICTED: protein LURP-one-related 5-like [... 67 4e-09 ref|XP_007215974.1| hypothetical protein PRUPE_ppa011580mg [Prun... 67 4e-09 ref|XP_010691138.1| PREDICTED: protein LURP-one-related 12 [Beta... 67 5e-09 ref|XP_009365431.1| PREDICTED: protein LURP-one-related 12-like ... 67 5e-09 ref|XP_008346624.1| PREDICTED: protein LURP-one-related 12-like ... 67 5e-09 ref|XP_007150755.1| hypothetical protein PHAVU_005G178100g [Phas... 67 5e-09 ref|XP_011012351.1| PREDICTED: protein LURP-one-related 5-like [... 67 7e-09 ref|XP_002517637.1| GTP binding protein, putative [Ricinus commu... 67 7e-09 ref|XP_002298251.1| hypothetical protein POPTR_0001s19270g [Popu... 67 7e-09 ref|XP_014499932.1| PREDICTED: protein LURP-one-related 12-like ... 66 1e-08 gb|KOM44603.1| hypothetical protein LR48_Vigan05g220800 [Vigna a... 66 1e-08 emb|CAN65825.1| hypothetical protein VITISV_034997 [Vitis vinifera] 66 1e-08 ref|XP_011044842.1| PREDICTED: protein LURP-one-related 5 [Popul... 65 2e-08 ref|XP_010250151.1| PREDICTED: protein LURP-one-related 12-like ... 65 2e-08 ref|XP_010063468.1| PREDICTED: protein LURP-one-related 5 [Eucal... 65 2e-08 >ref|XP_010247599.1| PREDICTED: protein LURP-one-related 12-like isoform X3 [Nelumbo nucifera] Length = 228 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS MVLGR+VFSLCLK GFDAAFAMGLVLVLDQI Sbjct: 167 RRKVDASTNMVLGRDVFSLCLKPGFDAAFAMGLVLVLDQI 206 >ref|XP_010247598.1| PREDICTED: protein LURP-one-related 12-like isoform X2 [Nelumbo nucifera] Length = 231 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS MVLGR+VFSLCLK GFDAAFAMGLVLVLDQI Sbjct: 170 RRKVDASTNMVLGRDVFSLCLKPGFDAAFAMGLVLVLDQI 209 >ref|XP_010247597.1| PREDICTED: protein LURP-one-related 12-like isoform X1 [Nelumbo nucifera] Length = 232 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS MVLGR+VFSLCLK GFDAAFAMGLVLVLDQI Sbjct: 171 RRKVDASTNMVLGRDVFSLCLKPGFDAAFAMGLVLVLDQI 210 >ref|XP_012073172.1| PREDICTED: protein LURP-one-related 5 [Jatropha curcas] gi|643729201|gb|KDP37081.1| hypothetical protein JCGZ_06137 [Jatropha curcas] Length = 206 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS +VLG++VFSLCLK GFDAAFAMGLVLVLDQ+ Sbjct: 148 RRKVDASTNVVLGKDVFSLCLKPGFDAAFAMGLVLVLDQL 187 >ref|XP_010097226.1| hypothetical protein L484_025775 [Morus notabilis] gi|587878286|gb|EXB67293.1| hypothetical protein L484_025775 [Morus notabilis] Length = 205 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS +VLG++VFSLCLK GFD AFAMGLVLVLDQI Sbjct: 148 RRKVDASTNVVLGKDVFSLCLKPGFDGAFAMGLVLVLDQI 187 >ref|XP_008228691.1| PREDICTED: protein LURP-one-related 5-like [Prunus mume] Length = 205 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS +VLG++VFSLC+K GFD AFAMGLVLVLDQI Sbjct: 148 RRKVDASTHVVLGKDVFSLCIKPGFDGAFAMGLVLVLDQI 187 >ref|XP_007215974.1| hypothetical protein PRUPE_ppa011580mg [Prunus persica] gi|462412124|gb|EMJ17173.1| hypothetical protein PRUPE_ppa011580mg [Prunus persica] Length = 205 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS +VLG++VFSLC+K GFD AFAMGLVLVLDQI Sbjct: 148 RRKVDASTHVVLGKDVFSLCIKPGFDGAFAMGLVLVLDQI 187 >ref|XP_010691138.1| PREDICTED: protein LURP-one-related 12 [Beta vulgaris subsp. vulgaris] gi|870848377|gb|KMT00666.1| hypothetical protein BVRB_9g219560 [Beta vulgaris subsp. vulgaris] Length = 216 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS+ +VLG++VFSL +KSGFDAAFAMGLVLVLDQI Sbjct: 146 RRKVDASSNVVLGKDVFSLFIKSGFDAAFAMGLVLVLDQI 185 >ref|XP_009365431.1| PREDICTED: protein LURP-one-related 12-like [Pyrus x bretschneideri] Length = 211 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS +VLG++VFSLCLK GFD AFAMG+VLVLDQI Sbjct: 148 RRKVDASTHVVLGKDVFSLCLKRGFDGAFAMGVVLVLDQI 187 >ref|XP_008346624.1| PREDICTED: protein LURP-one-related 12-like [Malus domestica] Length = 208 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS +VLG++VFSLCLK GFD AFAMG+VLVLDQI Sbjct: 148 RRKVDASTHVVLGKDVFSLCLKPGFDGAFAMGVVLVLDQI 187 >ref|XP_007150755.1| hypothetical protein PHAVU_005G178100g [Phaseolus vulgaris] gi|561024019|gb|ESW22749.1| hypothetical protein PHAVU_005G178100g [Phaseolus vulgaris] Length = 217 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVD + +VLGREVFSLC+K+GFDAAFAMG VLVLDQI Sbjct: 156 RRKVDPTTSVVLGREVFSLCVKAGFDAAFAMGFVLVLDQI 195 >ref|XP_011012351.1| PREDICTED: protein LURP-one-related 5-like [Populus euphratica] Length = 201 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS ++LG++VFSLCLK GFD AFAMGLVL+LDQI Sbjct: 148 RRKVDASTNVLLGKDVFSLCLKPGFDGAFAMGLVLILDQI 187 >ref|XP_002517637.1| GTP binding protein, putative [Ricinus communis] gi|223543269|gb|EEF44801.1| GTP binding protein, putative [Ricinus communis] Length = 206 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVD S +VLG++VFSLCLK GFD AFAMGLVLVLDQI Sbjct: 149 RRKVDTSTHVVLGKDVFSLCLKPGFDGAFAMGLVLVLDQI 188 >ref|XP_002298251.1| hypothetical protein POPTR_0001s19270g [Populus trichocarpa] gi|222845509|gb|EEE83056.1| hypothetical protein POPTR_0001s19270g [Populus trichocarpa] Length = 201 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS ++LG++VFSLCLK GFD AFAMGLVL+LDQI Sbjct: 148 RRKVDASTNVLLGKDVFSLCLKPGFDGAFAMGLVLILDQI 187 >ref|XP_014499932.1| PREDICTED: protein LURP-one-related 12-like [Vigna radiata var. radiata] Length = 217 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVD + +VLG+EVFSLC+K+GFDAAFAMG VLVLDQI Sbjct: 156 RRKVDPTTSVVLGKEVFSLCVKAGFDAAFAMGFVLVLDQI 195 >gb|KOM44603.1| hypothetical protein LR48_Vigan05g220800 [Vigna angularis] Length = 217 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVD + +VLG+EVFSLC+K+GFDAAFAMG VLVLDQI Sbjct: 156 RRKVDPTTSVVLGKEVFSLCVKAGFDAAFAMGFVLVLDQI 195 >emb|CAN65825.1| hypothetical protein VITISV_034997 [Vitis vinifera] Length = 207 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS ++LG++VF+LCLK GFD AFAMGLVLVLDQI Sbjct: 148 RRKVDASTHVMLGKDVFTLCLKPGFDGAFAMGLVLVLDQI 187 >ref|XP_011044842.1| PREDICTED: protein LURP-one-related 5 [Populus euphratica] Length = 205 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS +VLG++V SLCLK GFD AFAMGLVL+LDQI Sbjct: 148 RRKVDASTDVVLGKDVLSLCLKPGFDGAFAMGLVLILDQI 187 >ref|XP_010250151.1| PREDICTED: protein LURP-one-related 12-like [Nelumbo nucifera] Length = 217 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 +RKVDA +VLGR+VF LCLK GFDAAFAMGLVLVLDQI Sbjct: 155 KRKVDADTNVVLGRDVFWLCLKPGFDAAFAMGLVLVLDQI 194 >ref|XP_010063468.1| PREDICTED: protein LURP-one-related 5 [Eucalyptus grandis] gi|629105236|gb|KCW70705.1| hypothetical protein EUGRSUZ_F03873 [Eucalyptus grandis] Length = 212 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 301 RRKVDASAQMVLGREVFSLCLKSGFDAAFAMGLVLVLDQI 182 RRKVDAS +VLG++VFSLC+K GFD AFAMGLVLVLD+I Sbjct: 148 RRKVDASTNVVLGKDVFSLCVKPGFDGAFAMGLVLVLDRI 187