BLASTX nr result
ID: Cornus23_contig00015880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00015880 (255 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB12178.1| hypothetical protein B456_002G004600 [Gossypium r... 63 1e-07 gb|KJB12177.1| hypothetical protein B456_002G004600 [Gossypium r... 63 1e-07 gb|KJB12176.1| hypothetical protein B456_002G004600 [Gossypium r... 63 1e-07 gb|KJB12174.1| hypothetical protein B456_002G004600 [Gossypium r... 63 1e-07 gb|KJB12173.1| hypothetical protein B456_002G004600 [Gossypium r... 63 1e-07 ref|XP_009761813.1| PREDICTED: kinesin-related protein 11-like i... 63 1e-07 ref|XP_009761812.1| PREDICTED: kinesin-related protein 11-like i... 63 1e-07 ref|XP_009610726.1| PREDICTED: kinesin-related protein 11-like i... 63 1e-07 ref|XP_009610725.1| PREDICTED: kinesin-related protein 11-like i... 63 1e-07 ref|XP_014501420.1| PREDICTED: kinesin-related protein 11 [Vigna... 62 1e-07 ref|XP_014494147.1| PREDICTED: kinesin-related protein 11 isofor... 62 1e-07 ref|XP_014494146.1| PREDICTED: kinesin-related protein 11 isofor... 62 1e-07 gb|KRH60787.1| hypothetical protein GLYMA_04G009100 [Glycine max] 62 1e-07 gb|KRH24392.1| hypothetical protein GLYMA_12G038600 [Glycine max] 62 1e-07 gb|KOM50935.1| hypothetical protein LR48_Vigan08g176200 [Vigna a... 62 1e-07 gb|KOM42304.1| hypothetical protein LR48_Vigan04g250200 [Vigna a... 62 1e-07 ref|XP_010109758.1| hypothetical protein L484_008434 [Morus nota... 62 1e-07 ref|XP_012573251.1| PREDICTED: kinesin-related protein 11 isofor... 62 1e-07 ref|XP_012067192.1| PREDICTED: kinesin-II 85 kDa subunit isoform... 62 1e-07 ref|XP_011658552.1| PREDICTED: centromere-associated protein E i... 62 1e-07 >gb|KJB12178.1| hypothetical protein B456_002G004600 [Gossypium raimondii] Length = 1039 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 104 GT*ELICTVTPASSNMEETHNTLKFASRAKRVEI 3 G LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 382 GLVSLICTVTPASSNMEETHNTLKFASRAKRVEI 415 >gb|KJB12177.1| hypothetical protein B456_002G004600 [Gossypium raimondii] Length = 1027 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 104 GT*ELICTVTPASSNMEETHNTLKFASRAKRVEI 3 G LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 382 GLVSLICTVTPASSNMEETHNTLKFASRAKRVEI 415 >gb|KJB12176.1| hypothetical protein B456_002G004600 [Gossypium raimondii] Length = 819 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 104 GT*ELICTVTPASSNMEETHNTLKFASRAKRVEI 3 G LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 382 GLVSLICTVTPASSNMEETHNTLKFASRAKRVEI 415 >gb|KJB12174.1| hypothetical protein B456_002G004600 [Gossypium raimondii] Length = 1015 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 104 GT*ELICTVTPASSNMEETHNTLKFASRAKRVEI 3 G LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 382 GLVSLICTVTPASSNMEETHNTLKFASRAKRVEI 415 >gb|KJB12173.1| hypothetical protein B456_002G004600 [Gossypium raimondii] gi|763744736|gb|KJB12175.1| hypothetical protein B456_002G004600 [Gossypium raimondii] Length = 1038 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 104 GT*ELICTVTPASSNMEETHNTLKFASRAKRVEI 3 G LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 382 GLVSLICTVTPASSNMEETHNTLKFASRAKRVEI 415 >ref|XP_009761813.1| PREDICTED: kinesin-related protein 11-like isoform X2 [Nicotiana sylvestris] Length = 1063 Score = 62.8 bits (151), Expect = 1e-07 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -2 Query: 164 ADHI-WKDSNL-H*SSTEPPFEGT*ELICTVTPASSNMEETHNTLKFASRAKRVEI 3 A H+ ++DS L T G LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 363 ASHVPYRDSKLTRLLQTSLSGHGHVSLICTVTPASSNMEETHNTLKFASRAKRVEI 418 >ref|XP_009761812.1| PREDICTED: kinesin-related protein 11-like isoform X1 [Nicotiana sylvestris] Length = 1064 Score = 62.8 bits (151), Expect = 1e-07 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -2 Query: 164 ADHI-WKDSNL-H*SSTEPPFEGT*ELICTVTPASSNMEETHNTLKFASRAKRVEI 3 A H+ ++DS L T G LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 363 ASHVPYRDSKLTRLLQTSLSGHGHVSLICTVTPASSNMEETHNTLKFASRAKRVEI 418 >ref|XP_009610726.1| PREDICTED: kinesin-related protein 11-like isoform X2 [Nicotiana tomentosiformis] Length = 1063 Score = 62.8 bits (151), Expect = 1e-07 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -2 Query: 164 ADHI-WKDSNL-H*SSTEPPFEGT*ELICTVTPASSNMEETHNTLKFASRAKRVEI 3 A H+ ++DS L T G LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 363 ASHVPYRDSKLTRLLQTSLSGHGHVSLICTVTPASSNMEETHNTLKFASRAKRVEI 418 >ref|XP_009610725.1| PREDICTED: kinesin-related protein 11-like isoform X1 [Nicotiana tomentosiformis] Length = 1064 Score = 62.8 bits (151), Expect = 1e-07 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -2 Query: 164 ADHI-WKDSNL-H*SSTEPPFEGT*ELICTVTPASSNMEETHNTLKFASRAKRVEI 3 A H+ ++DS L T G LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 363 ASHVPYRDSKLTRLLQTSLSGHGHVSLICTVTPASSNMEETHNTLKFASRAKRVEI 418 >ref|XP_014501420.1| PREDICTED: kinesin-related protein 11 [Vigna radiata var. radiata] Length = 1081 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 389 LICTVTPASSNMEETHNTLKFASRAKRVEI 418 >ref|XP_014494147.1| PREDICTED: kinesin-related protein 11 isoform X2 [Vigna radiata var. radiata] Length = 1015 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 390 LICTVTPASSNMEETHNTLKFASRAKRVEI 419 >ref|XP_014494146.1| PREDICTED: kinesin-related protein 11 isoform X1 [Vigna radiata var. radiata] Length = 1074 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 390 LICTVTPASSNMEETHNTLKFASRAKRVEI 419 >gb|KRH60787.1| hypothetical protein GLYMA_04G009100 [Glycine max] Length = 1052 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 372 LICTVTPASSNMEETHNTLKFASRAKRVEI 401 >gb|KRH24392.1| hypothetical protein GLYMA_12G038600 [Glycine max] Length = 1089 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 431 LICTVTPASSNMEETHNTLKFASRAKRVEI 460 >gb|KOM50935.1| hypothetical protein LR48_Vigan08g176200 [Vigna angularis] Length = 1038 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 354 LICTVTPASSNMEETHNTLKFASRAKRVEI 383 >gb|KOM42304.1| hypothetical protein LR48_Vigan04g250200 [Vigna angularis] Length = 1075 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 389 LICTVTPASSNMEETHNTLKFASRAKRVEI 418 >ref|XP_010109758.1| hypothetical protein L484_008434 [Morus notabilis] gi|587937863|gb|EXC24663.1| hypothetical protein L484_008434 [Morus notabilis] Length = 1174 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 395 LICTVTPASSNMEETHNTLKFASRAKRVEI 424 >ref|XP_012573251.1| PREDICTED: kinesin-related protein 11 isoform X3 [Cicer arietinum] Length = 979 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 286 LICTVTPASSNMEETHNTLKFASRAKRVEI 315 >ref|XP_012067192.1| PREDICTED: kinesin-II 85 kDa subunit isoform X1 [Jatropha curcas] Length = 1090 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 393 LICTVTPASSNMEETHNTLKFASRAKRVEI 422 >ref|XP_011658552.1| PREDICTED: centromere-associated protein E isoform X3 [Cucumis sativus] Length = 1033 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 LICTVTPASSNMEETHNTLKFASRAKRVEI 3 LICTVTPASSNMEETHNTLKFASRAKRVEI Sbjct: 360 LICTVTPASSNMEETHNTLKFASRAKRVEI 389