BLASTX nr result
ID: Cornus23_contig00015795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00015795 (389 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010026651.1| PREDICTED: lysM domain receptor-like kinase ... 59 1e-06 gb|KCW59772.1| hypothetical protein EUGRSUZ_H02518 [Eucalyptus g... 59 1e-06 >ref|XP_010026651.1| PREDICTED: lysM domain receptor-like kinase 3 [Eucalyptus grandis] Length = 613 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +1 Query: 259 YDVSINSTRMFPFNCSKNIKTCSSMLYNNN-GLQEEQIASFYSV 387 Y VSI T M+PFNCS IKTC++ LY+ + GLQE+QIA++YSV Sbjct: 24 YQVSIKETEMYPFNCSDQIKTCNAFLYHYDVGLQEDQIAAYYSV 67 >gb|KCW59772.1| hypothetical protein EUGRSUZ_H02518 [Eucalyptus grandis] Length = 508 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +1 Query: 259 YDVSINSTRMFPFNCSKNIKTCSSMLYNNN-GLQEEQIASFYSV 387 Y VSI T M+PFNCS IKTC++ LY+ + GLQE+QIA++YSV Sbjct: 24 YQVSIKETEMYPFNCSDQIKTCNAFLYHYDVGLQEDQIAAYYSV 67