BLASTX nr result
ID: Cornus23_contig00015740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00015740 (529 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ37164.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkg... 94 4e-17 ref|YP_005352758.1| ndhA gene product (chloroplast) [Ginkgo bilo... 94 4e-17 ref|YP_001381679.1| NADH-plastoquinone oxidoreductase subunit 1 ... 79 1e-12 ref|YP_636354.1| NADH dehydrogenase subunit 1 (chloroplast) [Euc... 72 1e-10 gb|ADH94398.1| NADH-plastoquinone oxidoreductase subunit 7 (chlo... 72 1e-10 ref|YP_009163534.1| NADH-plastoquinone oxidoreductase subunit 1 ... 72 2e-10 ref|YP_008994533.1| NADH-plastoquinone oxidoreductase subunit 1 ... 72 2e-10 gb|ALN96813.1| NAD(P)H-quinone oxidoreductase chain 1 (chloropla... 71 3e-10 gb|ALJ78390.1| NADH dehydrogenase subunit 1 (plastid) [Plantago ... 71 3e-10 gb|ALJ78300.1| NADH dehydrogenase subunit 1 (plastid) [Plantago ... 71 3e-10 ref|YP_009171654.1| NADH-plastoquinone oxidoreductase subunit 1 ... 71 3e-10 ref|YP_009171923.1| NdhA (chloroplast) [Solanum nigrum] gi|83320... 71 3e-10 ref|YP_009171837.1| NdhA (chloroplast) [Solanum commersonii] gi|... 71 3e-10 ref|YP_009172113.1| NADH-plastoquinone oxidoreductase subunit 1 ... 71 3e-10 ref|YP_009172033.1| NADH-plastoquinone oxidoreductase subunit 1 ... 71 3e-10 ref|YP_009170232.1| NADH-plastoquinone oxidoreductase subunit 1 ... 71 3e-10 ref|YP_009166740.1| NADH-plastoquinone oxidoreductase subunit 1 ... 71 3e-10 ref|YP_009166661.1| NADH dehydrogenase subunit 1 (chloroplast) [... 71 3e-10 ref|YP_009164555.1| NADH-plastoquinone oxidoreductase subunit 1 ... 71 3e-10 gb|AKZ31500.1| NADH dehydrogenase subunit 1 (chloroplast) [Goode... 71 3e-10 >gb|AEQ37164.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkgo biloba] Length = 209 Score = 94.0 bits (232), Expect = 4e-17 Identities = 44/58 (75%), Positives = 48/58 (82%) Frame = -2 Query: 174 LEEPYEVKISCTVL**RWEQ*CYHRL*LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 +EEPYE K+S TVL R EQ C HRL L NS STVDI+EAQS+YGFWGWNLWRQPIGF Sbjct: 1 MEEPYEAKVSRTVLEKRLEQCCSHRLQLPNSLSTVDIIEAQSRYGFWGWNLWRQPIGF 58 >ref|YP_005352758.1| ndhA gene product (chloroplast) [Ginkgo biloba] gi|372862389|gb|AEX98471.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkgo biloba] gi|372862811|gb|AEX98888.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkgo biloba] gi|372862981|gb|AEX99056.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkgo biloba] Length = 209 Score = 94.0 bits (232), Expect = 4e-17 Identities = 44/58 (75%), Positives = 48/58 (82%) Frame = -2 Query: 174 LEEPYEVKISCTVL**RWEQ*CYHRL*LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 +EEPYE K+S TVL R EQ C HRL L NS STVDI+EAQS+YGFWGWNLWRQPIGF Sbjct: 1 MEEPYEAKVSRTVLEKRLEQCCSHRLQLPNSLSTVDIIEAQSRYGFWGWNLWRQPIGF 58 >ref|YP_001381679.1| NADH-plastoquinone oxidoreductase subunit 1 [Medicago truncatula] Length = 369 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 111 CYHRL*LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 CYHRL LSNS STVDIV+AQSKYGFWGWNLWRQPIGF Sbjct: 185 CYHRLGLSNSLSTVDIVDAQSKYGFWGWNLWRQPIGF 221 >ref|YP_636354.1| NADH dehydrogenase subunit 1 (chloroplast) [Eucalyptus globulus subsp. globulus] gi|108860826|sp|Q49KU3.1|NU1C_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic; AltName: Full=NAD(P)H dehydrogenase subunit 1; Short=NDH subunit 1; AltName: Full=NADH-plastoquinone oxidoreductase subunit 1 gi|60460863|gb|AAX21083.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Eucalyptus globulus subsp. globulus] Length = 363 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 111 CYHRL*LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 C + LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 179 CVINISLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >gb|ADH94398.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Syzygium cumini] Length = 363 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 111 CYHRL*LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 C + LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 179 CVINISLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009163534.1| NADH-plastoquinone oxidoreductase subunit 1 (plastid) [Eugenia uniflora] gi|913022833|gb|AKU71531.1| NADH-plastoquinone oxidoreductase subunit 1 (plastid) [Eugenia uniflora] Length = 362 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 111 CYHRL*LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 C + LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 178 CVLSISLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 214 >ref|YP_008994533.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) (chloroplast) [Hypseocharis bilobata] gi|540067611|gb|AGV02962.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Hypseocharis bilobata] Length = 362 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 111 CYHRL*LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 C + LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 178 CVLSISLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 214 >gb|ALN96813.1| NAD(P)H-quinone oxidoreductase chain 1 (chloroplast) [Angelica decursiva] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >gb|ALJ78390.1| NADH dehydrogenase subunit 1 (plastid) [Plantago media] gi|939462246|gb|ALJ78404.1| NADH dehydrogenase subunit 1 (plastid) [Plantago media] Length = 360 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >gb|ALJ78300.1| NADH dehydrogenase subunit 1 (plastid) [Plantago maritima] gi|939462151|gb|ALJ78310.1| NADH dehydrogenase subunit 1 (plastid) [Plantago maritima] Length = 360 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009171654.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Elaeagnus macrophylla] gi|814936701|gb|AKE36552.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Elaeagnus macrophylla] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009171923.1| NdhA (chloroplast) [Solanum nigrum] gi|833204802|gb|AKM22000.1| NdhA (chloroplast) [Solanum nigrum] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009171837.1| NdhA (chloroplast) [Solanum commersonii] gi|833204676|gb|AKM21914.1| NdhA (chloroplast) [Solanum commersonii] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009172113.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Machilus balansae] gi|929982457|gb|ALF35818.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Machilus balansae] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009172033.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Machilus yunnanensis] gi|929982376|gb|ALF35738.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Machilus yunnanensis] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009170232.1| NADH-plastoquinone oxidoreductase subunit 1 (plastid) [Colpothrinax cookii] gi|927679645|gb|ALE29022.1| NADH-plastoquinone oxidoreductase subunit 1 (plastid) [Colpothrinax cookii] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009166740.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Tanaecium tetragonolobum] gi|924443773|gb|ALB78308.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Tanaecium tetragonolobum] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009166661.1| NADH dehydrogenase subunit 1 (chloroplast) [Epipremnum aureum] gi|924254346|gb|ALB38639.1| NADH dehydrogenase subunit 1 (chloroplast) [Epipremnum aureum] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >ref|YP_009164555.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Sedum oryzifolium] gi|744672600|gb|AJD00204.1| NADH-plastoquinone oxidoreductase subunit 1 (chloroplast) [Sedum oryzifolium] Length = 361 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215 >gb|AKZ31500.1| NADH dehydrogenase subunit 1 (chloroplast) [Goodenia phillipsiae] Length = 363 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 1 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF Sbjct: 185 LSNSSSTVDIVEAQSKYGFWGWNLWRQPIGF 215