BLASTX nr result
ID: Cornus23_contig00014860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00014860 (293 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001797883.1| malate synthase [Parastagonospora nodorum SN... 136 5e-30 gb|AAS91580.1| malate synthase [Parastagonospora nodorum] 136 5e-30 ref|XP_003304049.1| hypothetical protein PTT_16469 [Pyrenophora ... 133 4e-29 ref|XP_001936529.1| malate synthase [Pyrenophora tritici-repenti... 133 4e-29 gb|ACI04510.1| malate synthase, partial [Parastagonospora nodoru... 133 6e-29 gb|KNG50174.1| malate synthase [Stemphylium lycopersici] 132 1e-28 ref|XP_014559462.1| hypothetical protein COCVIDRAFT_24222 [Bipol... 130 3e-28 ref|XP_007690265.1| hypothetical protein COCMIDRAFT_38815 [Bipol... 130 3e-28 ref|XP_007706656.1| hypothetical protein COCCADRAFT_437 [Bipolar... 130 3e-28 ref|XP_014084893.1| hypothetical protein COCC4DRAFT_35847 [Bipol... 130 3e-28 ref|XP_007694148.1| hypothetical protein COCSADRAFT_31909 [Bipol... 130 3e-28 ref|XP_003836451.1| similar to malate synthase [Leptosphaeria ma... 130 3e-28 ref|XP_008021781.1| hypothetical protein SETTUDRAFT_166954 [Seto... 130 4e-28 ref|XP_007781791.1| malate synthase, glyoxysomal [Coniosporium a... 121 2e-25 dbj|GAM86451.1| hypothetical protein ANO11243_044650 [fungal sp.... 115 2e-23 ref|XP_013339907.1| hypothetical protein AUEXF2481DRAFT_8526 [Au... 105 1e-20 gb|EKG13669.1| Malate synthase [Macrophomina phaseolina MS6] 105 2e-20 ref|XP_013427184.1| malate synthase [Aureobasidium namibiae CBS ... 104 3e-20 ref|XP_007587128.1| putative malate synthase protein [Neofusicoc... 103 4e-20 gb|KKY24153.1| putative malate synthase [Diplodia seriata] 102 8e-20 >ref|XP_001797883.1| malate synthase [Parastagonospora nodorum SN15] gi|111063894|gb|EAT85014.1| malate synthase [Parastagonospora nodorum SN15] Length = 543 Score = 136 bits (343), Expect = 5e-30 Identities = 68/72 (94%), Positives = 72/72 (100%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MAA+PDTILREVNILG+LND+NRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD Sbjct: 1 MAANPDTILREVNILGELNDQNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 60 Query: 37 KGNLLDFLPETR 2 KGNLLDFLPET+ Sbjct: 61 KGNLLDFLPETK 72 >gb|AAS91580.1| malate synthase [Parastagonospora nodorum] Length = 543 Score = 136 bits (343), Expect = 5e-30 Identities = 68/72 (94%), Positives = 72/72 (100%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MAA+PDTILREVNILG+LND+NRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD Sbjct: 1 MAANPDTILREVNILGELNDQNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 60 Query: 37 KGNLLDFLPETR 2 KGNLLDFLPET+ Sbjct: 61 KGNLLDFLPETK 72 >ref|XP_003304049.1| hypothetical protein PTT_16469 [Pyrenophora teres f. teres 0-1] gi|311319605|gb|EFQ87859.1| hypothetical protein PTT_16469 [Pyrenophora teres f. teres 0-1] Length = 543 Score = 133 bits (335), Expect = 4e-29 Identities = 66/72 (91%), Positives = 71/72 (98%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MAA+PD+ILREVNILG+LND+NRHILSKDA VFLALLHRTFNERRKALLQRRVIRQAELD Sbjct: 1 MAANPDSILREVNILGELNDQNRHILSKDACVFLALLHRTFNERRKALLQRRVIRQAELD 60 Query: 37 KGNLLDFLPETR 2 KGNLLDFLPET+ Sbjct: 61 KGNLLDFLPETK 72 >ref|XP_001936529.1| malate synthase [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983628|gb|EDU49116.1| malate synthase [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 525 Score = 133 bits (335), Expect = 4e-29 Identities = 66/72 (91%), Positives = 71/72 (98%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MAA+PD+ILREVNILG+LND+NRHILSKDA VFLALLHRTFNERRKALLQRRVIRQAELD Sbjct: 1 MAANPDSILREVNILGELNDQNRHILSKDACVFLALLHRTFNERRKALLQRRVIRQAELD 60 Query: 37 KGNLLDFLPETR 2 KGNLLDFLPET+ Sbjct: 61 KGNLLDFLPETK 72 >gb|ACI04510.1| malate synthase, partial [Parastagonospora nodorum] gi|205364094|gb|ACI04511.1| malate synthase, partial [Parastagonospora nodorum] Length = 531 Score = 133 bits (334), Expect = 6e-29 Identities = 66/70 (94%), Positives = 70/70 (100%) Frame = -2 Query: 211 ASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELDKG 32 A+PDTILREVNILG+LND+NRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELDKG Sbjct: 1 ANPDTILREVNILGELNDQNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELDKG 60 Query: 31 NLLDFLPETR 2 NLLDFLPET+ Sbjct: 61 NLLDFLPETK 70 >gb|KNG50174.1| malate synthase [Stemphylium lycopersici] Length = 543 Score = 132 bits (332), Expect = 1e-28 Identities = 65/72 (90%), Positives = 70/72 (97%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MAA+PD+ILREVNILGDL D+NRHILSKDA VFLALLHRTFNERRKALLQRRV+RQAELD Sbjct: 1 MAANPDSILREVNILGDLTDQNRHILSKDACVFLALLHRTFNERRKALLQRRVVRQAELD 60 Query: 37 KGNLLDFLPETR 2 KGNLLDFLPET+ Sbjct: 61 KGNLLDFLPETK 72 >ref|XP_014559462.1| hypothetical protein COCVIDRAFT_24222 [Bipolaris victoriae FI3] gi|578492551|gb|EUN29950.1| hypothetical protein COCVIDRAFT_24222 [Bipolaris victoriae FI3] Length = 542 Score = 130 bits (328), Expect = 3e-28 Identities = 65/70 (92%), Positives = 68/70 (97%) Frame = -2 Query: 211 ASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELDKG 32 A+P+ ILREVNILGDLNDKNRHILSKDA VFLALLHRTFNERRKALLQRRVIRQAELDKG Sbjct: 2 ANPERILREVNILGDLNDKNRHILSKDACVFLALLHRTFNERRKALLQRRVIRQAELDKG 61 Query: 31 NLLDFLPETR 2 NLLDFLPET+ Sbjct: 62 NLLDFLPETK 71 >ref|XP_007690265.1| hypothetical protein COCMIDRAFT_38815 [Bipolaris oryzae ATCC 44560] gi|576929607|gb|EUC43211.1| hypothetical protein COCMIDRAFT_38815 [Bipolaris oryzae ATCC 44560] Length = 542 Score = 130 bits (328), Expect = 3e-28 Identities = 65/70 (92%), Positives = 68/70 (97%) Frame = -2 Query: 211 ASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELDKG 32 A+P+ ILREVNILGDLNDKNRHILSKDA VFLALLHRTFNERRKALLQRRVIRQAELDKG Sbjct: 2 ANPERILREVNILGDLNDKNRHILSKDACVFLALLHRTFNERRKALLQRRVIRQAELDKG 61 Query: 31 NLLDFLPETR 2 NLLDFLPET+ Sbjct: 62 NLLDFLPETK 71 >ref|XP_007706656.1| hypothetical protein COCCADRAFT_437 [Bipolaris zeicola 26-R-13] gi|576924925|gb|EUC39032.1| hypothetical protein COCCADRAFT_437 [Bipolaris zeicola 26-R-13] Length = 542 Score = 130 bits (328), Expect = 3e-28 Identities = 65/70 (92%), Positives = 68/70 (97%) Frame = -2 Query: 211 ASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELDKG 32 A+P+ ILREVNILGDLNDKNRHILSKDA VFLALLHRTFNERRKALLQRRVIRQAELDKG Sbjct: 2 ANPERILREVNILGDLNDKNRHILSKDACVFLALLHRTFNERRKALLQRRVIRQAELDKG 61 Query: 31 NLLDFLPETR 2 NLLDFLPET+ Sbjct: 62 NLLDFLPETK 71 >ref|XP_014084893.1| hypothetical protein COCC4DRAFT_35847 [Bipolaris maydis ATCC 48331] gi|452003668|gb|EMD96125.1| hypothetical protein COCHEDRAFT_1127622 [Bipolaris maydis C5] gi|477593915|gb|ENI10984.1| hypothetical protein COCC4DRAFT_35847 [Bipolaris maydis ATCC 48331] Length = 542 Score = 130 bits (328), Expect = 3e-28 Identities = 65/70 (92%), Positives = 68/70 (97%) Frame = -2 Query: 211 ASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELDKG 32 A+P+ ILREVNILGDLNDKNRHILSKDA VFLALLHRTFNERRKALLQRRVIRQAELDKG Sbjct: 2 ANPERILREVNILGDLNDKNRHILSKDACVFLALLHRTFNERRKALLQRRVIRQAELDKG 61 Query: 31 NLLDFLPETR 2 NLLDFLPET+ Sbjct: 62 NLLDFLPETK 71 >ref|XP_007694148.1| hypothetical protein COCSADRAFT_31909 [Bipolaris sorokiniana ND90Pr] gi|451855855|gb|EMD69146.1| hypothetical protein COCSADRAFT_31909 [Bipolaris sorokiniana ND90Pr] Length = 542 Score = 130 bits (328), Expect = 3e-28 Identities = 65/70 (92%), Positives = 68/70 (97%) Frame = -2 Query: 211 ASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELDKG 32 A+P+ ILREVNILGDLNDKNRHILSKDA VFLALLHRTFNERRKALLQRRVIRQAELDKG Sbjct: 2 ANPERILREVNILGDLNDKNRHILSKDACVFLALLHRTFNERRKALLQRRVIRQAELDKG 61 Query: 31 NLLDFLPETR 2 NLLDFLPET+ Sbjct: 62 NLLDFLPETK 71 >ref|XP_003836451.1| similar to malate synthase [Leptosphaeria maculans JN3] gi|312213004|emb|CBX93086.1| similar to malate synthase [Leptosphaeria maculans JN3] Length = 543 Score = 130 bits (328), Expect = 3e-28 Identities = 65/72 (90%), Positives = 71/72 (98%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MAA+ D+ILREVNILG+LND+NRHILSKDAA+FLALLHRTFNERRKALLQRRVIRQAELD Sbjct: 1 MAANADSILREVNILGELNDQNRHILSKDAALFLALLHRTFNERRKALLQRRVIRQAELD 60 Query: 37 KGNLLDFLPETR 2 KGNLLDFLPET+ Sbjct: 61 KGNLLDFLPETK 72 >ref|XP_008021781.1| hypothetical protein SETTUDRAFT_166954 [Setosphaeria turcica Et28A] gi|482814475|gb|EOA91153.1| hypothetical protein SETTUDRAFT_166954 [Setosphaeria turcica Et28A] Length = 543 Score = 130 bits (327), Expect = 4e-28 Identities = 64/72 (88%), Positives = 69/72 (95%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MA +P+ ILREVNILGDLND+NRHILSKDA VFLALLHRTFNERRKALLQRRV+RQAELD Sbjct: 1 MAVNPERILREVNILGDLNDQNRHILSKDACVFLALLHRTFNERRKALLQRRVLRQAELD 60 Query: 37 KGNLLDFLPETR 2 KGNLLDFLPET+ Sbjct: 61 KGNLLDFLPETK 72 >ref|XP_007781791.1| malate synthase, glyoxysomal [Coniosporium apollinis CBS 100218] gi|494829893|gb|EON66474.1| malate synthase, glyoxysomal [Coniosporium apollinis CBS 100218] Length = 543 Score = 121 bits (304), Expect = 2e-25 Identities = 60/72 (83%), Positives = 66/72 (91%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MAA+PD +L++VNILG LNDK R ILSKDA VFLALLHRTFNERRKALLQRR+IRQAELD Sbjct: 1 MAANPDQVLKDVNILGQLNDKTRQILSKDATVFLALLHRTFNERRKALLQRRMIRQAELD 60 Query: 37 KGNLLDFLPETR 2 KGNL DFLPET+ Sbjct: 61 KGNLPDFLPETK 72 >dbj|GAM86451.1| hypothetical protein ANO11243_044650 [fungal sp. No.11243] Length = 543 Score = 115 bits (287), Expect = 2e-23 Identities = 59/72 (81%), Positives = 62/72 (86%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MA +PD LR+V +LG LNDK R ILSKDAAVFLALLHRTFN RKALLQRRVIRQAELD Sbjct: 1 MAPNPDETLRDVKVLGALNDKTRKILSKDAAVFLALLHRTFNSTRKALLQRRVIRQAELD 60 Query: 37 KGNLLDFLPETR 2 KGNL DFLPETR Sbjct: 61 KGNLPDFLPETR 72 >ref|XP_013339907.1| hypothetical protein AUEXF2481DRAFT_8526 [Aureobasidium subglaciale EXF-2481] gi|662534133|gb|KEQ91459.1| hypothetical protein AUEXF2481DRAFT_8526 [Aureobasidium subglaciale EXF-2481] Length = 543 Score = 105 bits (263), Expect = 1e-20 Identities = 54/72 (75%), Positives = 59/72 (81%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MA + D ILREVNILG LNDK R ++SKDA VFLALLHRTFN+ RK LLQRRV RQAELD Sbjct: 1 MAQNADHILREVNILGPLNDKTRKVISKDATVFLALLHRTFNKTRKELLQRRVARQAELD 60 Query: 37 KGNLLDFLPETR 2 G L DFLPET+ Sbjct: 61 AGKLPDFLPETK 72 >gb|EKG13669.1| Malate synthase [Macrophomina phaseolina MS6] Length = 557 Score = 105 bits (261), Expect = 2e-20 Identities = 52/75 (69%), Positives = 60/75 (80%) Frame = -2 Query: 226 KPTMAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQA 47 KP A +P +L++VNILG LND+ R L+KDA VFL +LHRTFN RRKALL RR IRQA Sbjct: 12 KPNPAPNPAAVLKDVNILGPLNDQTRKTLNKDAIVFLTVLHRTFNARRKALLDRRQIRQA 71 Query: 46 ELDKGNLLDFLPETR 2 ELDKGNL DFLPET+ Sbjct: 72 ELDKGNLPDFLPETK 86 >ref|XP_013427184.1| malate synthase [Aureobasidium namibiae CBS 147.97] gi|662515161|gb|KEQ72727.1| malate synthase [Aureobasidium namibiae CBS 147.97] Length = 543 Score = 104 bits (259), Expect = 3e-20 Identities = 52/72 (72%), Positives = 60/72 (83%) Frame = -2 Query: 217 MAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD 38 MA + D ILREVNILG LND+NR ++SK+A VFLALLHRTFN+ RK LLQRR+ RQAELD Sbjct: 1 MAQNQDHILREVNILGPLNDRNRKVISKEATVFLALLHRTFNKTRKELLQRRMTRQAELD 60 Query: 37 KGNLLDFLPETR 2 G L DFLPET+ Sbjct: 61 AGKLPDFLPETK 72 >ref|XP_007587128.1| putative malate synthase protein [Neofusicoccum parvum UCRNP2] gi|485918903|gb|EOD45400.1| putative malate synthase protein [Neofusicoccum parvum UCRNP2] Length = 587 Score = 103 bits (258), Expect = 4e-20 Identities = 53/82 (64%), Positives = 61/82 (74%) Frame = -2 Query: 247 TDTAAPTKPTMAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQ 68 T K A +P +L++VNILG LND+ IL+KDA VFL++LHRTFN RRKALL Sbjct: 35 TQFGTQAKANPAPNPAAVLKDVNILGPLNDQTSKILNKDAIVFLSVLHRTFNARRKALLD 94 Query: 67 RRVIRQAELDKGNLLDFLPETR 2 RR IRQAELDKGNL DFLPETR Sbjct: 95 RRQIRQAELDKGNLPDFLPETR 116 >gb|KKY24153.1| putative malate synthase [Diplodia seriata] Length = 557 Score = 102 bits (255), Expect = 8e-20 Identities = 54/80 (67%), Positives = 62/80 (77%) Frame = -2 Query: 241 TAAPTKPTMAASPDTILREVNILGDLNDKNRHILSKDAAVFLALLHRTFNERRKALLQRR 62 T A T P A +P +L++VNI G LND+ R IL+KDA VFLA+LHR FN RRK LL+RR Sbjct: 9 TQAKTNP--APNPAAVLKDVNISGPLNDQTRKILNKDAIVFLAVLHRAFNARRKQLLERR 66 Query: 61 VIRQAELDKGNLLDFLPETR 2 IRQAELDKGNL DFLPETR Sbjct: 67 QIRQAELDKGNLPDFLPETR 86