BLASTX nr result
ID: Cornus23_contig00014055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00014055 (747 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 92 1e-18 gb|KMT09216.1| hypothetical protein BVRB_6g133180 [Beta vulgaris... 59 3e-06 gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Erythr... 59 3e-06 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 91.7 bits (226), Expect(2) = 1e-18 Identities = 49/66 (74%), Positives = 54/66 (81%) Frame = +1 Query: 22 MKVDYLSIHLKTSIIPSRTKHKSFDSFGSHAQLLQLLMVNYHIFFF*CNEPILSSLFIFQ 201 MKVDY SI + SIIPSRTKH+SFDSFGSHAQLL+ VN HIFF+ CNEPI SSLFIFQ Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLK---VNSHIFFYECNEPIFSSLFIFQ 57 Query: 202 NKNSET 219 K+ ET Sbjct: 58 -KDIET 62 Score = 29.3 bits (64), Expect(2) = 1e-18 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 224 PKYSEDSSDQTKNM 265 PKYSEDSSD+ KNM Sbjct: 66 PKYSEDSSDKIKNM 79 >gb|KMT09216.1| hypothetical protein BVRB_6g133180 [Beta vulgaris subsp. vulgaris] Length = 221 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 516 SFNHVKGPTLLVDRESKWIYQ*ITKCYGSYI 608 SFNHV PTLLVDRESK+IYQ ITKCYGSYI Sbjct: 191 SFNHVNDPTLLVDRESKYIYQQITKCYGSYI 221 >gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Erythranthe guttata] Length = 70 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 22 MKVDYLSIHLKTSIIPSRTKHKSFDSFGSHAQLLQ 126 MKVDYL +H K SIIPSRTKH+S DSFGSH QLL+ Sbjct: 1 MKVDYLFVHFKASIIPSRTKHESKDSFGSHVQLLR 35