BLASTX nr result
ID: Cornus23_contig00013872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00013872 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009258952.1| hypothetical protein FPSE_07559 [Fusarium ps... 58 2e-06 ref|XP_003661510.1| hypothetical protein MYCTH_2300995 [Myceliop... 57 5e-06 >ref|XP_009258952.1| hypothetical protein FPSE_07559 [Fusarium pseudograminearum CS3096] gi|408392992|gb|EKJ72265.1| hypothetical protein FPSE_07559 [Fusarium pseudograminearum CS3096] Length = 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/61 (47%), Positives = 36/61 (59%) Frame = -1 Query: 303 MSSRGTYSSSALPMSPTPPSDLPSYARFMHQHTKKQMEEAXXXXXXXXXXXXRVAPTMPN 124 M +R Y S ++ MSPTPPS+L SYARFMH HTK+QME + R +M N Sbjct: 1 MPARSDYGSVSMSMSPTPPSNLSSYARFMHDHTKRQMEASGASPPPSNATAQRARSSMTN 60 Query: 123 G 121 G Sbjct: 61 G 61 >ref|XP_003661510.1| hypothetical protein MYCTH_2300995 [Myceliophthora thermophila ATCC 42464] gi|347008778|gb|AEO56265.1| hypothetical protein MYCTH_2300995 [Myceliophthora thermophila ATCC 42464] Length = 77 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 300 SSRGTYSSSALPMSPTPPSDLPSYARFMHQHTKKQME 190 +S+ TYS+S +P+SP PPSDL SY+RFMHQHTK+QME Sbjct: 3 TSQRTYSTS-MPLSPPPPSDLGSYSRFMHQHTKRQME 38