BLASTX nr result
ID: Cornus23_contig00013492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00013492 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007045912.1| Uncharacterized protein isoform 1 [Theobroma... 60 8e-07 ref|XP_007045913.1| Uncharacterized protein isoform 2 [Theobroma... 56 9e-06 ref|XP_007224589.1| hypothetical protein PRUPE_ppa1027132mg [Pru... 56 9e-06 >ref|XP_007045912.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508709847|gb|EOY01744.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 526 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = -3 Query: 163 MGFKQPFDEEVFQESPFKHTRQLEYGLKLISFTDIFPFHEAPQKTDIPDIAD 8 MGFK+PFD+E QE PFK+ RQ +Y K+ F D FP PQK I ++ D Sbjct: 1 MGFKRPFDDEELQELPFKNLRQFDYSNKMTQFADTFPRSNTPQKPHISEVED 52 >ref|XP_007045913.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508709848|gb|EOY01745.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 527 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -3 Query: 163 MGFKQPFDEEVFQESPFKHTRQLEYGLKLISFTDIFPFHEAPQKTDI 23 MGFK+PFD+E QE PFK+ RQ +Y K+ F D FP PQK I Sbjct: 1 MGFKRPFDDEELQELPFKNLRQFDYSNKMTQFADTFPRSNTPQKPHI 47 >ref|XP_007224589.1| hypothetical protein PRUPE_ppa1027132mg [Prunus persica] gi|462421525|gb|EMJ25788.1| hypothetical protein PRUPE_ppa1027132mg [Prunus persica] Length = 511 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = -3 Query: 163 MGFKQPFDEEVFQESPFKHTRQLEYGLKLISFTDIFPFHEAPQKTDIPD 17 MGFK+PFD+ FQE PFKH RQLE+ KL F+D + AP+KT + + Sbjct: 1 MGFKRPFDDVDFQELPFKHPRQLEFSDKLAPFSDAVSCYGAPRKTYVSE 49