BLASTX nr result
ID: Cornus23_contig00013329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00013329 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ33467.1| hypothetical protein EV44_g1325 [Erysiphe necator] 82 2e-13 >gb|KHJ33467.1| hypothetical protein EV44_g1325 [Erysiphe necator] Length = 196 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/76 (52%), Positives = 56/76 (73%) Frame = -2 Query: 279 HPTWDGPVKRSRKFSREQRDSLRNWGWDQAQSPSSPFESLRRSLSIHSEISPGTSPHNSY 100 +PTW GP K+SRK+SREQRDSLR+WGW+++Q PS+ E R S++ ISPGTSP+NS+ Sbjct: 105 YPTWGGPAKKSRKYSREQRDSLRSWGWEKSQ-PSTSLECRSRHSSMYG-ISPGTSPNNSF 162 Query: 99 INLPPCRDDGFGSAGQ 52 + D+ F +AG+ Sbjct: 163 SHSHISFDNAFEAAGR 178