BLASTX nr result
ID: Cornus23_contig00013099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00013099 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009767489.1| PREDICTED: floral homeotic protein APETALA 2... 57 7e-06 ref|XP_012079274.1| PREDICTED: floral homeotic protein APETALA 2... 56 9e-06 ref|XP_012079272.1| PREDICTED: floral homeotic protein APETALA 2... 56 9e-06 >ref|XP_009767489.1| PREDICTED: floral homeotic protein APETALA 2 [Nicotiana sylvestris] Length = 498 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 107 RAYDKAVIKCNGKESVTNFDSNIYENKLHFTDRA 6 RAYDKAVIKCNGK++VTNFD +IYEN+L+ T+ A Sbjct: 285 RAYDKAVIKCNGKDAVTNFDRSIYENELNSTEPA 318 >ref|XP_012079274.1| PREDICTED: floral homeotic protein APETALA 2 isoform X3 [Jatropha curcas] Length = 489 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -1 Query: 107 RAYDKAVIKCNGKESVTNFDSNIYENKLHFTDRAG 3 RAYDKA IKCNGKE+VTNFD +IYEN+L+ ++ +G Sbjct: 287 RAYDKAAIKCNGKEAVTNFDPSIYENELNSSESSG 321 >ref|XP_012079272.1| PREDICTED: floral homeotic protein APETALA 2 isoform X1 [Jatropha curcas] gi|317106692|dbj|BAJ53193.1| JHL03K20.2 [Jatropha curcas] gi|643722090|gb|KDP31969.1| hypothetical protein JCGZ_12430 [Jatropha curcas] Length = 493 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -1 Query: 107 RAYDKAVIKCNGKESVTNFDSNIYENKLHFTDRAG 3 RAYDKA IKCNGKE+VTNFD +IYEN+L+ ++ +G Sbjct: 287 RAYDKAAIKCNGKEAVTNFDPSIYENELNSSESSG 321