BLASTX nr result
ID: Cornus23_contig00012635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00012635 (336 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007783115.1| hypothetical protein W97_07053 [Coniosporium... 79 1e-12 gb|KIW08513.1| hypothetical protein PV09_01407 [Verruconis gallo... 73 7e-11 gb|KKY14311.1| putative actin cytoskeleton protein [Diplodia ser... 70 6e-10 gb|EKG20059.1| hypothetical protein MPH_02634 [Macrophomina phas... 70 8e-10 ref|XP_007293943.1| RNA recognition domain-containing protein [M... 69 1e-09 ref|XP_007585083.1| putative actin cytoskeleton protein [Neofusi... 69 2e-09 gb|EMF11250.1| hypothetical protein SEPMUDRAFT_150229 [Sphaeruli... 67 5e-09 ref|XP_001594819.1| hypothetical protein SS1G_04627 [Sclerotinia... 64 4e-08 gb|EMR84476.1| putative rna recognition domain-containing protei... 61 3e-07 ref|XP_001561068.1| hypothetical protein BC1G_00153 [Botrytis ci... 61 3e-07 gb|ESZ98840.1| hypothetical protein SBOR_0698 [Sclerotinia borea... 61 4e-07 ref|XP_007932177.1| hypothetical protein MYCFIDRAFT_158260 [Pseu... 60 5e-07 ref|XP_007804698.1| hypothetical protein EPUS_03660 [Endocarpon ... 59 1e-06 ref|XP_008083118.1| RNA-binding, RBD [Glarea lozoyensis ATCC 208... 58 2e-06 gb|KJX98744.1| RNA recognition domain-containing protein [Zymose... 58 3e-06 gb|KEQ64323.1| hypothetical protein M437DRAFT_74152 [Aureobasidi... 57 4e-06 gb|KFY14184.1| hypothetical protein V492_02793 [Pseudogymnoascus... 57 5e-06 ref|XP_007680023.1| hypothetical protein BAUCODRAFT_151038 [Baud... 57 5e-06 gb|KFZ08393.1| hypothetical protein V501_05978 [Pseudogymnoascus... 56 9e-06 >ref|XP_007783115.1| hypothetical protein W97_07053 [Coniosporium apollinis CBS 100218] gi|494831318|gb|EON67798.1| hypothetical protein W97_07053 [Coniosporium apollinis CBS 100218] Length = 319 Score = 79.3 bits (194), Expect = 1e-12 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -2 Query: 332 TAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*KGTK 186 ++G++ +PGT++TKCNCGAD GKCPCEPG CACS C KN EV++ G + Sbjct: 227 SSGMKSVPGTDRTKCNCGADTGKCPCEPGKCACSDCAKNPEVESKAGAE 275 Score = 70.1 bits (170), Expect = 6e-10 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 335 ETAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAE 210 E G+EK+ G+++TKCNCG++ G CPC PG CACSSC KN E Sbjct: 275 EEMGMEKVAGSDRTKCNCGSEAGNCPCPPGKCACSSCAKNPE 316 >gb|KIW08513.1| hypothetical protein PV09_01407 [Verruconis gallopava] Length = 327 Score = 73.2 bits (178), Expect = 7e-11 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 335 ETAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAE 210 E AGLE +PGT+KTKCNCGA KCPCEPG CAC+ C KN + Sbjct: 270 EEAGLEVVPGTDKTKCNCGATAEKCPCEPGKCACAKCAKNPD 311 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -2 Query: 302 NKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*K 195 ++T CNCGA LGKC C PG CACS+C KN + K K Sbjct: 231 SRTTCNCGATLGKCGCAPGTCACSNCAKNPDAKTSK 266 >gb|KKY14311.1| putative actin cytoskeleton protein [Diplodia seriata] Length = 294 Score = 70.1 bits (170), Expect = 6e-10 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 335 ETAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA 201 E A +E +PGT+KTKCNC ++ GKCPCEPG CAC+ C K+ E A Sbjct: 241 EEAQMEIVPGTDKTKCNCSSEAGKCPCEPGKCACAGCGKSTEAAA 285 >gb|EKG20059.1| hypothetical protein MPH_02634 [Macrophomina phaseolina MS6] Length = 291 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -2 Query: 335 ETAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA 201 E A +E IPGT KTKCNCGA KCPCEPG CAC+ C K+ E A Sbjct: 238 EEAEMEVIPGTEKTKCNCGATSEKCPCEPGKCACAGCAKSTETAA 282 >ref|XP_007293943.1| RNA recognition domain-containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862994|gb|EKD16043.1| RNA recognition domain-containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 367 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -2 Query: 329 AGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*KGTKGTS 177 A EK+PGT+KT C CG D+ CPC PGACAC SCPK E K GT T+ Sbjct: 260 ASTEKVPGTDKTTCKCGGDIKNCPCAPGACACDSCPK-VETKKVAGTDKTT 309 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/62 (48%), Positives = 36/62 (58%) Frame = -2 Query: 335 ETAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*KGTKGTS*EG*SVP 156 +T ++K+PGT KT CNCG D CPC PGACACS CPK + K K T G + Sbjct: 221 KTTYVKKVPGTEKTTCNCGGDTANCPCAPGACACSGCPKASTEKVPGTDKTTCKCGGDIK 280 Query: 155 RC 150 C Sbjct: 281 NC 282 >ref|XP_007585083.1| putative actin cytoskeleton protein [Neofusicoccum parvum UCRNP2] gi|485921837|gb|EOD47461.1| putative actin cytoskeleton protein [Neofusicoccum parvum UCRNP2] Length = 296 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -2 Query: 335 ETAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA 201 E A +E +PGT KTKCNCGA KCPCEPG CAC+ C K+ E A Sbjct: 237 EEAEMEIVPGTEKTKCNCGATTEKCPCEPGKCACAGCAKSTESAA 281 >gb|EMF11250.1| hypothetical protein SEPMUDRAFT_150229 [Sphaerulina musiva SO2202] Length = 310 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -2 Query: 335 ETAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNA 213 E A LEKIPGT KTKCNCG KC CE G CAC+SCPK++ Sbjct: 270 EEAELEKIPGTEKTKCNCGGADAKCACEAGKCACASCPKSS 310 >ref|XP_001594819.1| hypothetical protein SS1G_04627 [Sclerotinia sclerotiorum 1980] gi|154702412|gb|EDO02151.1| hypothetical protein SS1G_04627 [Sclerotinia sclerotiorum 1980 UF-70] Length = 330 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = -2 Query: 326 GLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*KGTKGTS 177 G +K+PGT KT C CG+ G+CPC PGACACS C K ++VK GT T+ Sbjct: 221 GPQKVPGTEKTTCKCGSVSGECPCAPGACACSDCGK-SDVKKVPGTDKTT 269 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/49 (48%), Positives = 35/49 (71%) Frame = -2 Query: 323 LEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*KGTKGTS 177 ++K+PGT+KT C CG + KC C PG C+C+SCPK AE + G++ T+ Sbjct: 259 VKKVPGTDKTTCGCGGNTSKCGCAPGQCSCNSCPK-AETEKVPGSEKTT 306 >gb|EMR84476.1| putative rna recognition domain-containing protein [Botrytis cinerea BcDW1] Length = 342 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -2 Query: 326 GLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*KGTKGTS 177 G +K+PGT KT C CG+ G+CPC PG+CACS C K ++VK G+ T+ Sbjct: 221 GPQKVPGTEKTTCKCGSVSGECPCAPGSCACSDCGK-SDVKKVPGSDKTT 269 >ref|XP_001561068.1| hypothetical protein BC1G_00153 [Botrytis cinerea B05.10] Length = 299 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -2 Query: 326 GLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*KGTKGTS 177 G +K+PGT KT C CG+ G+CPC PG+CACS C K ++VK G+ T+ Sbjct: 190 GPQKVPGTEKTTCKCGSVSGECPCAPGSCACSDCGK-SDVKKVPGSDKTT 238 >gb|ESZ98840.1| hypothetical protein SBOR_0698 [Sclerotinia borealis F-4157] Length = 304 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = -2 Query: 320 EKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*KGTKGTS 177 +K+PGT KT C CG+ G CPC PG+CACS C K ++VK GT T+ Sbjct: 223 QKVPGTEKTTCKCGSVSGDCPCAPGSCACSDCGK-SDVKKVPGTDKTT 269 >ref|XP_007932177.1| hypothetical protein MYCFIDRAFT_158260 [Pseudocercospora fijiensis CIRAD86] gi|452977662|gb|EME77428.1| hypothetical protein MYCFIDRAFT_158260 [Pseudocercospora fijiensis CIRAD86] Length = 309 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/43 (58%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = -2 Query: 335 ETAGLEKI--PGTNKTKCNCGADLGKCPCEPGACACSSCPKNA 213 E A +EK+ G KTKCNC GKCPCEPG CAC+ CPK++ Sbjct: 267 EEAEMEKVIVAGQEKTKCNCAGAEGKCPCEPGKCACTGCPKSS 309 >ref|XP_007804698.1| hypothetical protein EPUS_03660 [Endocarpon pusillum Z07020] gi|539432814|gb|ERF69668.1| hypothetical protein EPUS_03660 [Endocarpon pusillum Z07020] Length = 287 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = -2 Query: 320 EKIPGTNKTKCNCGADLGKCPCEPGACACSSCPK 219 E + GT+KT CNCGAD G+CPCEP CAC++C K Sbjct: 230 ETVAGTDKTVCNCGADTGECPCEPEKCACANCGK 263 >ref|XP_008083118.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868] gi|512200177|gb|EPE29009.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868] Length = 305 Score = 58.2 bits (139), Expect = 2e-06 Identities = 20/40 (50%), Positives = 29/40 (72%) Frame = -2 Query: 335 ETAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKN 216 + +G+ +PGT KT C CG++ +CPC PGACAC+ C K+ Sbjct: 222 QDSGVTTVPGTEKTTCKCGSNAEQCPCAPGACACTGCEKS 261 >gb|KJX98744.1| RNA recognition domain-containing protein [Zymoseptoria brevis] Length = 341 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/43 (55%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = -2 Query: 335 ETAGLEKIP--GTNKTKCNCGADLGKCPCEPGACACSSCPKNA 213 E A +EK+ G KTKCNCG + KCPC G CAC+SCPK++ Sbjct: 299 EQAEMEKVTVGGQEKTKCNCGGNEAKCPCAAGKCACASCPKSS 341 >gb|KEQ64323.1| hypothetical protein M437DRAFT_74152 [Aureobasidium melanogenum CBS 110374] Length = 311 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/33 (63%), Positives = 24/33 (72%) Frame = -2 Query: 308 GTNKTKCNCGADLGKCPCEPGACACSSCPKNAE 210 G KTKC+C +D G CPC PG CACS C KN+E Sbjct: 230 GEGKTKCSCASDAGSCPCAPGHCACSGCAKNSE 262 >gb|KFY14184.1| hypothetical protein V492_02793 [Pseudogymnoascus pannorum VKM F-4246] Length = 354 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/50 (48%), Positives = 30/50 (60%) Frame = -2 Query: 329 AGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA*KGTKGT 180 A + +PGT+KT CNCG D C CE G CAC+SC K ++ A K T Sbjct: 248 AAKKAVPGTDKTTCNCGGDNEVCSCEVGQCACASCAKKSKTAATSAAKTT 297 >ref|XP_007680023.1| hypothetical protein BAUCODRAFT_151038 [Baudoinia panamericana UAMH 10762] gi|449296594|gb|EMC92613.1| hypothetical protein BAUCODRAFT_151038 [Baudoinia panamericana UAMH 10762] Length = 286 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/42 (52%), Positives = 29/42 (69%) Frame = -2 Query: 335 ETAGLEKIPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAE 210 E+ + + G N+TKCNCG G CPCEPG CAC++C KN + Sbjct: 228 ESMNMHNVEG-NRTKCNCGGAEGVCPCEPGKCACTTCAKNPD 268 >gb|KFZ08393.1| hypothetical protein V501_05978 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 334 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -2 Query: 314 IPGTNKTKCNCGADLGKCPCEPGACACSSCPKNAEVKA 201 +PGT+KT C+CG D C CE G CACSSCPK + +A Sbjct: 252 VPGTDKTTCSCGGDNEICSCEVGQCACSSCPKASRTEA 289