BLASTX nr result
ID: Cornus23_contig00012414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00012414 (250 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098868.1| putative glycosyltransferase [Morus notabili... 59 1e-06 >ref|XP_010098868.1| putative glycosyltransferase [Morus notabilis] gi|587887155|gb|EXB75956.1| putative glycosyltransferase [Morus notabilis] Length = 465 Score = 58.9 bits (141), Expect = 1e-06 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 5/81 (6%) Frame = -3 Query: 230 ANDSVVNDSASPPLSTEAID---IQERVRK-KEDSLNVSTNEPPIVSSM-NETLPIPMTM 66 ++DS+ N S+SPPL+ EAI QE KE+S N+S +EP IV + NE+ +P+ Sbjct: 15 SDDSLFNRSSSPPLAIEAISPSPSQEHSNDTKENSFNISASEPQIVVPLVNESRVVPLVK 74 Query: 65 AGLQKEFSNLERLEASLVQVR 3 A +E+S+LERLEA L++ R Sbjct: 75 ARRHREYSDLERLEARLMKAR 95