BLASTX nr result
ID: Cornus23_contig00012049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00012049 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane prot... 57 4e-06 emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] 57 5e-06 ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane prot... 57 5e-06 emb|CDP00288.1| unnamed protein product [Coffea canephora] 57 5e-06 ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane prot... 57 5e-06 ref|NP_001275134.1| mitochondrial outer membrane protein porin o... 57 5e-06 ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane prot... 57 5e-06 ref|XP_012448173.1| PREDICTED: mitochondrial outer membrane prot... 56 9e-06 ref|XP_012478650.1| PREDICTED: mitochondrial outer membrane prot... 56 9e-06 gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium r... 56 9e-06 gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gos... 56 9e-06 gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gos... 56 9e-06 ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane prot... 56 9e-06 >ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Nicotiana sylvestris] Length = 276 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAKVGLAVALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKVGLAVALKP 276 >emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] Length = 276 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAK+GLAVALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Nicotiana tomentosiformis] Length = 276 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAK+GLAVALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >emb|CDP00288.1| unnamed protein product [Coffea canephora] Length = 276 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAK+GLAVALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Solanum lycopersicum] Length = 276 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAK+GLAVALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum tuberosum] gi|1172556|sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent anion-selective channel protein; Short=VDAC gi|515360|emb|CAA56600.1| 36kDA porin II [Solanum tuberosum] Length = 276 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAK+GLAVALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Nicotiana sylvestris] gi|161788874|dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum] Length = 276 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAK+GLAVALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_012448173.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Gossypium raimondii] gi|763793743|gb|KJB60739.1| hypothetical protein B456_009G323300 [Gossypium raimondii] Length = 276 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAKVGLA+ALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >ref|XP_012478650.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Gossypium raimondii] gi|823157535|ref|XP_012478651.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Gossypium raimondii] gi|823157537|ref|XP_012478652.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Gossypium raimondii] gi|763762764|gb|KJB30018.1| hypothetical protein B456_005G139100 [Gossypium raimondii] gi|763762765|gb|KJB30019.1| hypothetical protein B456_005G139100 [Gossypium raimondii] Length = 276 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAKVGLA+ALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium raimondii] Length = 255 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAKVGLA+ALKP Sbjct: 226 PKSLFTISGEVDTRAIEKSAKVGLALALKP 255 >gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum] Length = 276 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAKVGLA+ALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum] Length = 276 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAKVGLA+ALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Nelumbo nucifera] Length = 276 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 348 PKSLFTISGEVDTMAIEKSAKVGLAVALKP 259 PKSLFTISGEVDT AIEKSAKVGLA+ALKP Sbjct: 247 PKSLFTISGEVDTRAIEKSAKVGLALALKP 276