BLASTX nr result
ID: Cornus23_contig00011688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00011688 (603 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ35773.1| putative eukaryotic translation initiation factor... 70 9e-10 emb|CCU77913.1| putative eukaryotic translation initiation facto... 70 1e-09 gb|EPQ63213.1| Translation initiation factor eIF-5 [Blumeria gra... 70 1e-09 ref|XP_008087910.1| ARM repeat-containing protein [Glarea lozoye... 70 1e-09 gb|KIN07422.1| hypothetical protein OIDMADRAFT_186017 [Oidiodend... 69 3e-09 ref|XP_007288264.1| eukaryotic translation initiation factor 5 [... 69 3e-09 ref|XP_008718635.1| hypothetical protein HMPREF1541_06076 [Cyphe... 67 1e-08 gb|EYE91640.1| putative eukaryotic translation initiation factor... 66 1e-08 ref|XP_007785442.1| hypothetical protein EPUS_05801 [Endocarpon ... 66 1e-08 dbj|GAA86480.1| eukaryotic translation initiation factor 5 [Aspe... 66 1e-08 ref|XP_001395537.1| eukaryotic translation initiation factor 5 [... 66 1e-08 dbj|GAQ06810.1| probable eukaryotic translation initiation facto... 66 2e-08 gb|KNG89512.1| eukaryotic translation initiation factor 5 [Asper... 66 2e-08 ref|XP_001826376.1| eukaryotic translation initiation factor 5 [... 66 2e-08 dbj|GAO86840.1| probable eukaryotic translation initiation facto... 66 2e-08 gb|KMK62075.1| eukaryotic translation initiation factor 5, putat... 66 2e-08 gb|KJK61489.1| C-terminal W2 domain of eukaryotic translation in... 66 2e-08 ref|XP_013319819.1| hypothetical protein PV05_03698 [Exophiala x... 66 2e-08 gb|KIV92096.1| hypothetical protein PV10_06563 [Exophiala mesoph... 66 2e-08 ref|XP_007722959.1| translation initiation factor 5 [Capronia co... 66 2e-08 >gb|KHJ35773.1| putative eukaryotic translation initiation factor 5 [Erysiphe necator] Length = 428 Score = 70.1 bits (170), Expect = 9e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 33 >emb|CCU77913.1| putative eukaryotic translation initiation factor 5 [Blumeria graminis f. sp. hordei DH14] Length = 415 Score = 69.7 bits (169), Expect = 1e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIRSD+KDPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRSDIKDPFYRYKMERLQSKIEGKGNGI 33 >gb|EPQ63213.1| Translation initiation factor eIF-5 [Blumeria graminis f. sp. tritici 96224] Length = 415 Score = 69.7 bits (169), Expect = 1e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIRSD+KDPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRSDIKDPFYRYKMERLQSKIEGKGNGI 33 >ref|XP_008087910.1| ARM repeat-containing protein [Glarea lozoyensis ATCC 20868] gi|361129499|gb|EHL01405.1| putative Eukaryotic translation initiation factor 5 [Glarea lozoyensis 74030] gi|512196158|gb|EPE24995.1| ARM repeat-containing protein [Glarea lozoyensis ATCC 20868] Length = 426 Score = 69.7 bits (169), Expect = 1e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MAT+NIRSDVKDPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATINIRSDVKDPFYRYKMERLQSKIEGKGNGI 33 >gb|KIN07422.1| hypothetical protein OIDMADRAFT_186017 [Oidiodendron maius Zn] Length = 425 Score = 68.6 bits (166), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MAT+NIRSDVKDPFYRYKME+LQSKIEGKGNGI Sbjct: 1 MATINIRSDVKDPFYRYKMEKLQSKIEGKGNGI 33 >ref|XP_007288264.1| eukaryotic translation initiation factor 5 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406868225|gb|EKD21262.1| eukaryotic translation initiation factor 5 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 427 Score = 68.6 bits (166), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MAT+NIRSDVKDPFYRYKME+LQSKIEGKGNGI Sbjct: 1 MATINIRSDVKDPFYRYKMEKLQSKIEGKGNGI 33 >ref|XP_008718635.1| hypothetical protein HMPREF1541_06076 [Cyphellophora europaea CBS 101466] gi|568117233|gb|ETN39850.1| hypothetical protein HMPREF1541_06076 [Cyphellophora europaea CBS 101466] Length = 422 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR+DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRTDVTDPFYRYKMERLQSKIEGKGNGI 33 >gb|EYE91640.1| putative eukaryotic translation initiation factor 5 [Aspergillus ruber CBS 135680] Length = 422 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVSDPFYRYKMERLQSKIEGKGNGI 33 >ref|XP_007785442.1| hypothetical protein EPUS_05801 [Endocarpon pusillum Z07020] gi|539442288|gb|ERF77232.1| hypothetical protein EPUS_05801 [Endocarpon pusillum Z07020] Length = 425 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVSDPFYRYKMERLQSKIEGKGNGI 33 >dbj|GAA86480.1| eukaryotic translation initiation factor 5 [Aspergillus kawachii IFO 4308] Length = 424 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVSDPFYRYKMERLQSKIEGKGNGI 33 >ref|XP_001395537.1| eukaryotic translation initiation factor 5 [Aspergillus niger CBS 513.88] gi|134080255|emb|CAK97158.1| unnamed protein product [Aspergillus niger] gi|350636884|gb|EHA25242.1| translation initiation factor eIF5 [Aspergillus niger ATCC 1015] Length = 425 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVSDPFYRYKMERLQSKIEGKGNGI 33 >dbj|GAQ06810.1| probable eukaryotic translation initiation factor 5 [Aspergillus lentulus] Length = 421 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVTDPFYRYKMERLQSKIEGKGNGI 33 >gb|KNG89512.1| eukaryotic translation initiation factor 5 [Aspergillus nomius NRRL 13137] Length = 423 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVTDPFYRYKMERLQSKIEGKGNGI 33 >ref|XP_001826376.1| eukaryotic translation initiation factor 5 [Aspergillus oryzae RIB40] gi|238493653|ref|XP_002378063.1| eukaryotic translation initiation factor 5, putative [Aspergillus flavus NRRL3357] gi|83775120|dbj|BAE65243.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220696557|gb|EED52899.1| eukaryotic translation initiation factor 5, putative [Aspergillus flavus NRRL3357] gi|391869462|gb|EIT78660.1| translation initiation factor 5 [Aspergillus oryzae 3.042] gi|635510574|gb|KDE82503.1| translation initiation factor 5 [Aspergillus oryzae 100-8] gi|768705479|gb|KJJ32228.1| putative eukaryotic translation initiation factor 5 [Aspergillus flavus AF70] Length = 422 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVTDPFYRYKMERLQSKIEGKGNGI 33 >dbj|GAO86840.1| probable eukaryotic translation initiation factor 5 [Neosartorya udagawae] Length = 422 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVTDPFYRYKMERLQSKIEGKGNGI 33 >gb|KMK62075.1| eukaryotic translation initiation factor 5, putative [Aspergillus fumigatus Z5] Length = 421 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVTDPFYRYKMERLQSKIEGKGNGI 33 >gb|KJK61489.1| C-terminal W2 domain of eukaryotic translation initiation factor 5 [Aspergillus parasiticus SU-1] Length = 423 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVTDPFYRYKMERLQSKIEGKGNGI 33 >ref|XP_013319819.1| hypothetical protein PV05_03698 [Exophiala xenobiotica] gi|759282732|gb|KIW59235.1| hypothetical protein PV05_03698 [Exophiala xenobiotica] Length = 426 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MATVNIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATVNIRRDVTDPFYRYKMERLQSKIEGKGNGI 33 >gb|KIV92096.1| hypothetical protein PV10_06563 [Exophiala mesophila] Length = 428 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MAT+NIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATINIRRDVSDPFYRYKMERLQSKIEGKGNGI 33 >ref|XP_007722959.1| translation initiation factor 5 [Capronia coronata CBS 617.96] gi|590015564|gb|EXJ90765.1| translation initiation factor 5 [Capronia coronata CBS 617.96] Length = 428 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 99 MATVNIRSDVKDPFYRYKMERLQSKIEGKGNGI 1 MAT+NIR DV DPFYRYKMERLQSKIEGKGNGI Sbjct: 1 MATINIRRDVSDPFYRYKMERLQSKIEGKGNGI 33