BLASTX nr result
ID: Cornus23_contig00011175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00011175 (372 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244090.1| PREDICTED: grpE protein homolog, mitochondri... 66 1e-08 ref|XP_006346189.1| PREDICTED: grpE protein homolog, mitochondri... 64 3e-08 ref|XP_009795857.1| PREDICTED: grpE protein homolog, mitochondri... 59 1e-06 ref|XP_009795856.1| PREDICTED: grpE protein homolog, mitochondri... 59 1e-06 ref|XP_009795855.1| PREDICTED: grpE protein homolog, mitochondri... 59 1e-06 ref|XP_004251913.1| PREDICTED: grpE protein homolog, mitochondri... 59 2e-06 ref|XP_009589167.1| PREDICTED: grpE protein homolog, mitochondri... 56 9e-06 ref|XP_009589166.1| PREDICTED: grpE protein homolog, mitochondri... 56 9e-06 >ref|XP_004244090.1| PREDICTED: grpE protein homolog, mitochondrial [Solanum lycopersicum] Length = 299 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -2 Query: 182 MASSRFSSRLPKGVLAQCRNSLLLYARQQHHHHLPISSNQFHSLRESQNKV 30 M SR SSR + VL QCRNSLLLY RQ HH+PI S+QFHS+R + KV Sbjct: 1 MVLSRISSRFSRNVLTQCRNSLLLYYRQNQQHHVPILSSQFHSIRNIREKV 51 >ref|XP_006346189.1| PREDICTED: grpE protein homolog, mitochondrial-like [Solanum tuberosum] Length = 295 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -2 Query: 182 MASSRFSSRLPKGVLAQCRNSLLLYARQQHHHHLPISSNQFHSLRESQNKV 30 M SR SSR + +L QCRNSLLLY RQ HHLPI S QFHS+R + KV Sbjct: 1 MVLSRISSRFSRNMLTQCRNSLLLYYRQNQQHHLPILSCQFHSIRNIREKV 51 >ref|XP_009795857.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X3 [Nicotiana sylvestris] Length = 302 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -2 Query: 182 MASSRFSSRLPKGVLAQCRNSLLLYAR-QQHHHHLPISSNQFHSLRESQNKV 30 M SR SSR P+ +L QCR+S+LLY+R QQ H+P+ ++QFHSLR+ + KV Sbjct: 1 MLVSRISSRFPRAILNQCRSSVLLYSREQQRKQHVPVLASQFHSLRDFKEKV 52 >ref|XP_009795856.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X2 [Nicotiana sylvestris] Length = 304 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -2 Query: 182 MASSRFSSRLPKGVLAQCRNSLLLYAR-QQHHHHLPISSNQFHSLRESQNKV 30 M SR SSR P+ +L QCR+S+LLY+R QQ H+P+ ++QFHSLR+ + KV Sbjct: 1 MLVSRISSRFPRAILNQCRSSVLLYSREQQRKQHVPVLASQFHSLRDFKEKV 52 >ref|XP_009795855.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 [Nicotiana sylvestris] Length = 337 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -2 Query: 182 MASSRFSSRLPKGVLAQCRNSLLLYAR-QQHHHHLPISSNQFHSLRESQNKV 30 M SR SSR P+ +L QCR+S+LLY+R QQ H+P+ ++QFHSLR+ + KV Sbjct: 1 MLVSRISSRFPRAILNQCRSSVLLYSREQQRKQHVPVLASQFHSLRDFKEKV 52 >ref|XP_004251913.1| PREDICTED: grpE protein homolog, mitochondrial [Solanum lycopersicum] Length = 335 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/54 (51%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -2 Query: 182 MASSRFSSRLPKGVLAQCRNSLLLYAR-QQHHHHLPISSNQFHSLRESQNKVVV 24 M R SSR PK ++AQCR+SLLLY+R QQ ++PI +++FHS RE + KV + Sbjct: 1 MLVGRISSRFPKSIVAQCRSSLLLYSREQQQQQYVPIFASEFHSFREFKEKVTL 54 >ref|XP_009589167.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X2 [Nicotiana tomentosiformis] Length = 302 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/52 (51%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -2 Query: 182 MASSRFSSRLPKGVLAQCRNSLLLYAR-QQHHHHLPISSNQFHSLRESQNKV 30 M SR SSR + +L QCR+S+LLY+R QQ H+P+ ++QFHSLR+ + KV Sbjct: 1 MLVSRISSRFRRAILNQCRSSVLLYSREQQRQQHVPVLASQFHSLRDFKEKV 52 >ref|XP_009589166.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] Length = 304 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/52 (51%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -2 Query: 182 MASSRFSSRLPKGVLAQCRNSLLLYAR-QQHHHHLPISSNQFHSLRESQNKV 30 M SR SSR + +L QCR+S+LLY+R QQ H+P+ ++QFHSLR+ + KV Sbjct: 1 MLVSRISSRFRRAILNQCRSSVLLYSREQQRQQHVPVLASQFHSLRDFKEKV 52