BLASTX nr result
ID: Cornus23_contig00011088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00011088 (400 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010090688.1| NAC domain-containing protein 29 [Morus nota... 75 1e-11 emb|CDP13390.1| unnamed protein product [Coffea canephora] 75 1e-11 ref|XP_002264588.1| PREDICTED: NAC transcription factor NAM-B1 [... 75 1e-11 gb|AKE81095.1| apical meristem (NAM) family protein [Populus tom... 75 2e-11 ref|XP_011036132.1| PREDICTED: NAC domain-containing protein 18-... 75 2e-11 ref|XP_002297860.1| no apical meristem family protein [Populus t... 75 2e-11 gb|AGT01909.1| NAC transcription factor [Camellia sinensis] 75 2e-11 gb|AIA57524.1| NAC domain-containing protein [Boehmeria nivea] 74 3e-11 gb|ALC79012.1| NAC transcription factors 35 [Manihot esculenta] 74 4e-11 gb|ALC79011.1| NAC transcription factors 34 [Manihot esculenta] 74 4e-11 ref|XP_012459997.1| PREDICTED: NAC transcription factor 25 [Goss... 74 4e-11 gb|KJB77205.1| hypothetical protein B456_012G125500 [Gossypium r... 74 4e-11 ref|XP_010556110.1| PREDICTED: NAC transcription factor 29-like ... 74 4e-11 ref|XP_010533371.1| PREDICTED: NAC domain-containing protein 18-... 74 4e-11 gb|AHF27223.1| NAC transcription factor [Hevea brasiliensis] 74 4e-11 ref|XP_010024206.1| PREDICTED: NAC transcription factor 25-like ... 74 4e-11 ref|XP_012088760.1| PREDICTED: NAC transcription factor 25 [Jatr... 74 4e-11 ref|XP_012479573.1| PREDICTED: NAC transcription factor 29-like ... 73 9e-11 ref|XP_008459893.1| PREDICTED: NAC domain-containing protein 18 ... 73 9e-11 gb|AGC27322.1| NAC domain protein 7 [Gossypium hirsutum] 73 9e-11 >ref|XP_010090688.1| NAC domain-containing protein 29 [Morus notabilis] gi|587850163|gb|EXB40352.1| NAC domain-containing protein 29 [Morus notabilis] Length = 277 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRKA 2 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRKA Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRKA 36 >emb|CDP13390.1| unnamed protein product [Coffea canephora] Length = 278 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRKA 2 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRKA Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRKA 36 >ref|XP_002264588.1| PREDICTED: NAC transcription factor NAM-B1 [Vitis vinifera] gi|296088719|emb|CBI38169.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRKA 2 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRKA Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRKA 36 >gb|AKE81095.1| apical meristem (NAM) family protein [Populus tomentosa] Length = 257 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >ref|XP_011036132.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica] Length = 257 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >ref|XP_002297860.1| no apical meristem family protein [Populus trichocarpa] gi|222845118|gb|EEE82665.1| no apical meristem family protein [Populus trichocarpa] Length = 257 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >gb|AGT01909.1| NAC transcription factor [Camellia sinensis] Length = 231 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >gb|AIA57524.1| NAC domain-containing protein [Boehmeria nivea] Length = 157 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRKA 2 M+KL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRKA Sbjct: 1 MDKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRKA 36 >gb|ALC79012.1| NAC transcription factors 35 [Manihot esculenta] Length = 254 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >gb|ALC79011.1| NAC transcription factors 34 [Manihot esculenta] Length = 254 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >ref|XP_012459997.1| PREDICTED: NAC transcription factor 25 [Gossypium raimondii] gi|586637249|gb|AHJ79193.1| NAC domain protein NAC52 [Gossypium hirsutum] gi|763810302|gb|KJB77204.1| hypothetical protein B456_012G125500 [Gossypium raimondii] Length = 254 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYL+RK Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLRRK 35 >gb|KJB77205.1| hypothetical protein B456_012G125500 [Gossypium raimondii] Length = 182 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYL+RK Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLRRK 35 >ref|XP_010556110.1| PREDICTED: NAC transcription factor 29-like [Tarenaya hassleriana] Length = 262 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >ref|XP_010533371.1| PREDICTED: NAC domain-containing protein 18-like [Tarenaya hassleriana] gi|729440456|ref|XP_010521426.1| PREDICTED: NAC domain-containing protein 18-like [Tarenaya hassleriana] Length = 260 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >gb|AHF27223.1| NAC transcription factor [Hevea brasiliensis] Length = 254 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >ref|XP_010024206.1| PREDICTED: NAC transcription factor 25-like [Eucalyptus grandis] gi|629094667|gb|KCW60662.1| hypothetical protein EUGRSUZ_H03387 [Eucalyptus grandis] Length = 259 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEK+SFVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKVSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >ref|XP_012088760.1| PREDICTED: NAC transcription factor 25 [Jatropha curcas] gi|495025389|gb|AGL39667.1| NAC transcription factor 011 [Jatropha curcas] gi|643708375|gb|KDP23291.1| hypothetical protein JCGZ_23124 [Jatropha curcas] Length = 251 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >ref|XP_012479573.1| PREDICTED: NAC transcription factor 29-like [Gossypium raimondii] gi|763764275|gb|KJB31529.1| hypothetical protein B456_005G195300 [Gossypium raimondii] Length = 255 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYL+RK Sbjct: 2 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLRRK 36 >ref|XP_008459893.1| PREDICTED: NAC domain-containing protein 18 [Cucumis melo] Length = 257 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 M+KL+FVKNGVLRLPPGFRFHPTDEELVVQYLKRK Sbjct: 1 MDKLNFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 35 >gb|AGC27322.1| NAC domain protein 7 [Gossypium hirsutum] Length = 277 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 109 MEKLSFVKNGVLRLPPGFRFHPTDEELVVQYLKRK 5 MEKL+FVKNGVLRLPPGFRFHPTDEELVVQYL+RK Sbjct: 1 MEKLNFVKNGVLRLPPGFRFHPTDEELVVQYLRRK 35