BLASTX nr result
ID: Cornus23_contig00010305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00010305 (374 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA21017.1| DNA-binding protein [Daucus carota] 57 5e-06 >dbj|BAA21017.1| DNA-binding protein [Daucus carota] Length = 151 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 279 MKRLSSSDSMGALMSICPTTEHSPAGNNHVY 371 MKRLSSSDS+GALMSICPTTE GNNHVY Sbjct: 1 MKRLSSSDSLGALMSICPTTEEGSPGNNHVY 31