BLASTX nr result
ID: Cornus23_contig00010108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00010108 (297 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001795059.1| hypothetical protein SNOG_04645 [Parastagono... 69 1e-09 >ref|XP_001795059.1| hypothetical protein SNOG_04645 [Parastagonospora nodorum SN15] gi|160706362|gb|EAT88405.2| hypothetical protein SNOG_04645 [Parastagonospora nodorum SN15] Length = 353 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 199 FEHKAHAGFHMRRGDYKKDNVCTVYTTVYETAL 297 +EHKAHAGFHMRRGDYKKD+VCTVYTTVY TA+ Sbjct: 19 YEHKAHAGFHMRRGDYKKDDVCTVYTTVYVTAM 51