BLASTX nr result
ID: Cornus23_contig00009794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00009794 (827 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212287.1| hypothetical protein PRUPE_ppa013880mg [Prun... 191 5e-46 gb|AIF73143.1| ubiquitin-like family protein [Camellia sinensis ... 190 1e-45 ref|XP_008385845.1| PREDICTED: small ubiquitin-related modifier ... 190 1e-45 ref|XP_010252550.1| PREDICTED: small ubiquitin-related modifier ... 189 2e-45 ref|XP_008449142.1| PREDICTED: small ubiquitin-related modifier ... 189 3e-45 ref|XP_008364572.1| PREDICTED: small ubiquitin-related modifier ... 189 3e-45 ref|XP_004149348.1| PREDICTED: small ubiquitin-related modifier ... 188 4e-45 ref|XP_012070895.1| PREDICTED: small ubiquitin-related modifier ... 186 1e-44 ref|XP_004150752.1| PREDICTED: small ubiquitin-related modifier ... 185 3e-44 ref|XP_002529470.1| conserved hypothetical protein [Ricinus comm... 185 4e-44 ref|XP_012462554.1| PREDICTED: small ubiquitin-related modifier ... 184 9e-44 ref|XP_012443872.1| PREDICTED: small ubiquitin-related modifier ... 184 9e-44 gb|KHF98733.1| Small ubiquitin-related modifier 2 -like protein ... 184 9e-44 ref|XP_008456407.1| PREDICTED: small ubiquitin-related modifier ... 184 9e-44 ref|XP_012443871.1| PREDICTED: small ubiquitin-related modifier ... 183 1e-43 ref|XP_004294441.1| PREDICTED: small ubiquitin-related modifier ... 183 1e-43 gb|KJB62895.1| hypothetical protein B456_009G442500 [Gossypium r... 182 2e-43 ref|XP_006447642.1| hypothetical protein CICLE_v10017283mg [Citr... 182 2e-43 ref|XP_004513888.1| PREDICTED: small ubiquitin-related modifier ... 182 2e-43 gb|AFK36023.1| unknown [Lotus japonicus] 182 3e-43 >ref|XP_007212287.1| hypothetical protein PRUPE_ppa013880mg [Prunus persica] gi|645241250|ref|XP_008226991.1| PREDICTED: small ubiquitin-related modifier 1 [Prunus mume] gi|462408152|gb|EMJ13486.1| hypothetical protein PRUPE_ppa013880mg [Prunus persica] Length = 98 Score = 191 bits (485), Expect = 5e-46 Identities = 94/95 (98%), Positives = 94/95 (98%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVE NSIA Sbjct: 2 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 350 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA Sbjct: 62 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 96 >gb|AIF73143.1| ubiquitin-like family protein [Camellia sinensis var. sinensis] Length = 98 Score = 190 bits (482), Expect = 1e-45 Identities = 93/97 (95%), Positives = 95/97 (97%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 SGVTNQEED KPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVE NSIA Sbjct: 2 SGVTNQEEDNKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATV 344 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG++V Sbjct: 62 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGSSV 98 >ref|XP_008385845.1| PREDICTED: small ubiquitin-related modifier 1 [Malus domestica] gi|658047157|ref|XP_008359255.1| PREDICTED: small ubiquitin-related modifier 1 [Malus domestica] gi|694411589|ref|XP_009334152.1| PREDICTED: small ubiquitin-related modifier 1 [Pyrus x bretschneideri] Length = 98 Score = 190 bits (482), Expect = 1e-45 Identities = 93/95 (97%), Positives = 94/95 (98%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVE NSIA Sbjct: 2 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 350 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG+ Sbjct: 62 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGS 96 >ref|XP_010252550.1| PREDICTED: small ubiquitin-related modifier 1 [Nelumbo nucifera] Length = 98 Score = 189 bits (481), Expect = 2e-45 Identities = 92/97 (94%), Positives = 95/97 (97%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 S VTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSV+LNSIA Sbjct: 2 SAVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDLNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATV 344 FLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGGAT+ Sbjct: 62 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGATI 98 >ref|XP_008449142.1| PREDICTED: small ubiquitin-related modifier 1-like [Cucumis melo] Length = 166 Score = 189 bits (479), Expect = 3e-45 Identities = 92/97 (94%), Positives = 96/97 (98%) Frame = -2 Query: 643 RMSSGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELN 464 ++ SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+LN Sbjct: 65 QIMSGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLN 124 Query: 463 SIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 353 SIAFLFDGRRLRAEQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 125 SIAFLFDGRRLRAEQTPEELEMEDGDEIDAMLHQTGG 161 >ref|XP_008364572.1| PREDICTED: small ubiquitin-related modifier 1 [Malus domestica] gi|694363600|ref|XP_009361041.1| PREDICTED: small ubiquitin-related modifier 1 [Pyrus x bretschneideri] Length = 98 Score = 189 bits (479), Expect = 3e-45 Identities = 92/95 (96%), Positives = 94/95 (98%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 SGVTNQEEDKKPTDQ+AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVE NSIA Sbjct: 2 SGVTNQEEDKKPTDQAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 350 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG+ Sbjct: 62 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGS 96 >ref|XP_004149348.1| PREDICTED: small ubiquitin-related modifier 1 [Cucumis sativus] gi|700200970|gb|KGN56103.1| hypothetical protein Csa_3G073930 [Cucumis sativus] Length = 100 Score = 188 bits (478), Expect = 4e-45 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+LNSIA Sbjct: 2 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 353 FLFDGRRLRAEQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 62 FLFDGRRLRAEQTPEELEMEDGDEIDAMLHQTGG 95 >ref|XP_012070895.1| PREDICTED: small ubiquitin-related modifier 1 [Jatropha curcas] gi|643731991|gb|KDP39183.1| hypothetical protein JCGZ_00940 [Jatropha curcas] Length = 98 Score = 186 bits (473), Expect = 1e-44 Identities = 91/94 (96%), Positives = 92/94 (97%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 SGV+NQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVE NSIA Sbjct: 2 SGVSNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 353 FLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGG Sbjct: 62 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 95 >ref|XP_004150752.1| PREDICTED: small ubiquitin-related modifier 1 [Cucumis sativus] gi|700191790|gb|KGN46994.1| hypothetical protein Csa_6G157680 [Cucumis sativus] Length = 100 Score = 185 bits (470), Expect = 3e-44 Identities = 93/98 (94%), Positives = 95/98 (96%), Gaps = 2/98 (2%) Frame = -2 Query: 634 SGVTN--QEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNS 461 SGVTN QEEDKKP DQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+LNS Sbjct: 2 SGVTNTQQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLNS 61 Query: 460 IAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAT 347 IAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG+T Sbjct: 62 IAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGST 99 >ref|XP_002529470.1| conserved hypothetical protein [Ricinus communis] gi|223531086|gb|EEF32936.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 185 bits (469), Expect = 4e-44 Identities = 93/96 (96%), Positives = 93/96 (96%), Gaps = 1/96 (1%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSA-HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSI 458 SGVTNQEEDKKPTDQSA HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVE NSI Sbjct: 2 SGVTNQEEDKKPTDQSAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSI 61 Query: 457 AFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 350 AFLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGGA Sbjct: 62 AFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGA 97 >ref|XP_012462554.1| PREDICTED: small ubiquitin-related modifier 1-like [Gossypium raimondii] gi|763814869|gb|KJB81721.1| hypothetical protein B456_013G158500 [Gossypium raimondii] Length = 98 Score = 184 bits (466), Expect = 9e-44 Identities = 89/95 (93%), Positives = 92/95 (96%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 SGVTNQEEDKKP DQ+AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ NSIA Sbjct: 2 SGVTNQEEDKKPADQTAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 350 FLFDGRRLR EQTPDELEME+GDEIDAMLHQTGGA Sbjct: 62 FLFDGRRLRVEQTPDELEMEEGDEIDAMLHQTGGA 96 >ref|XP_012443872.1| PREDICTED: small ubiquitin-related modifier 1-like isoform X2 [Gossypium raimondii] gi|763795901|gb|KJB62897.1| hypothetical protein B456_009G442500 [Gossypium raimondii] Length = 98 Score = 184 bits (466), Expect = 9e-44 Identities = 89/94 (94%), Positives = 91/94 (96%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 +GVTNQEEDKKP DQ+AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVE NSIA Sbjct: 2 TGVTNQEEDKKPADQTAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 353 FLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGG Sbjct: 62 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 95 >gb|KHF98733.1| Small ubiquitin-related modifier 2 -like protein [Gossypium arboreum] Length = 98 Score = 184 bits (466), Expect = 9e-44 Identities = 89/95 (93%), Positives = 92/95 (96%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 SGVTNQEEDKKP DQ+AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ NSIA Sbjct: 2 SGVTNQEEDKKPADQTAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 350 FLFDGRRLR EQTPDELEME+GDEIDAMLHQTGGA Sbjct: 62 FLFDGRRLRGEQTPDELEMEEGDEIDAMLHQTGGA 96 >ref|XP_008456407.1| PREDICTED: small ubiquitin-related modifier 1 [Cucumis melo] Length = 100 Score = 184 bits (466), Expect = 9e-44 Identities = 92/98 (93%), Positives = 95/98 (96%), Gaps = 2/98 (2%) Frame = -2 Query: 634 SGVTN--QEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNS 461 SGVTN QEEDKKP DQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+LNS Sbjct: 2 SGVTNTQQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLNS 61 Query: 460 IAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAT 347 IAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG++ Sbjct: 62 IAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGSS 99 >ref|XP_012443871.1| PREDICTED: small ubiquitin-related modifier 1-like isoform X1 [Gossypium raimondii] Length = 107 Score = 183 bits (465), Expect = 1e-43 Identities = 91/100 (91%), Positives = 95/100 (95%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 +GVTNQEEDKKP DQ+AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ NSIA Sbjct: 2 TGVTNQEEDKKPADQTAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATV*LH 335 FLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGG T+ LH Sbjct: 62 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG-TMALH 100 >ref|XP_004294441.1| PREDICTED: small ubiquitin-related modifier 1 [Fragaria vesca subsp. vesca] Length = 98 Score = 183 bits (465), Expect = 1e-43 Identities = 89/97 (91%), Positives = 93/97 (95%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 SGVTNQEEDKKP DQ+AHINLKVK QDGNEVFFRIKR+TQLKKLMNAYCDRQSV+ N+IA Sbjct: 2 SGVTNQEEDKKPADQAAHINLKVKSQDGNEVFFRIKRNTQLKKLMNAYCDRQSVDFNAIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATV 344 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA V Sbjct: 62 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAIV 98 >gb|KJB62895.1| hypothetical protein B456_009G442500 [Gossypium raimondii] gi|763795900|gb|KJB62896.1| hypothetical protein B456_009G442500 [Gossypium raimondii] gi|763795902|gb|KJB62898.1| hypothetical protein B456_009G442500 [Gossypium raimondii] Length = 98 Score = 182 bits (463), Expect = 2e-43 Identities = 88/94 (93%), Positives = 91/94 (96%) Frame = -2 Query: 634 SGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 +GVTNQEEDKKP DQ+AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ NSIA Sbjct: 2 TGVTNQEEDKKPADQTAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 61 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 353 FLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGG Sbjct: 62 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 95 >ref|XP_006447642.1| hypothetical protein CICLE_v10017283mg [Citrus clementina] gi|568830674|ref|XP_006469615.1| PREDICTED: small ubiquitin-related modifier 1-like [Citrus sinensis] gi|557550253|gb|ESR60882.1| hypothetical protein CICLE_v10017283mg [Citrus clementina] Length = 101 Score = 182 bits (463), Expect = 2e-43 Identities = 92/96 (95%), Positives = 92/96 (95%), Gaps = 2/96 (2%) Frame = -2 Query: 634 SGVTN--QEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNS 461 SGVTN QEEDKKP DQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNS Sbjct: 2 SGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNS 61 Query: 460 IAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 353 IAFLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGG Sbjct: 62 IAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 97 >ref|XP_004513888.1| PREDICTED: small ubiquitin-related modifier 1-like [Cicer arietinum] Length = 100 Score = 182 bits (463), Expect = 2e-43 Identities = 91/100 (91%), Positives = 94/100 (94%), Gaps = 1/100 (1%) Frame = -2 Query: 640 MSSGVTNQEEDKKPTDQS-AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELN 464 MSSGV N +EDKKPTDQ AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ N Sbjct: 1 MSSGVVNNDEDKKPTDQGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFN 60 Query: 463 SIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATV 344 SIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG+ V Sbjct: 61 SIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGSVV 100 >gb|AFK36023.1| unknown [Lotus japonicus] Length = 102 Score = 182 bits (461), Expect = 3e-43 Identities = 91/97 (93%), Positives = 92/97 (94%), Gaps = 1/97 (1%) Frame = -2 Query: 631 GVTNQEEDKKPTDQS-AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 455 GVTN EEDKKPTDQ AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ NSIA Sbjct: 6 GVTNNEEDKKPTDQGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 65 Query: 454 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATV 344 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA V Sbjct: 66 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAVV 102