BLASTX nr result
ID: Cornus23_contig00009604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00009604 (624 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog... 98 3e-18 ref|XP_009359839.1| PREDICTED: respiratory burst oxidase homolog... 98 3e-18 ref|XP_008369593.1| PREDICTED: respiratory burst oxidase homolog... 98 3e-18 ref|XP_008222292.1| PREDICTED: respiratory burst oxidase homolog... 98 3e-18 gb|AGI65628.1| NADPH oxidase, partial [Fragaria x ananassa] 98 3e-18 ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog... 98 3e-18 ref|XP_007225362.1| hypothetical protein PRUPE_ppa000883mg [Prun... 98 3e-18 gb|AKS03954.1| respiratory burst oxidase-like protein 1 [Rubia c... 98 4e-18 ref|XP_009353482.1| PREDICTED: respiratory burst oxidase homolog... 97 6e-18 gb|AII25876.1| NADPH oxidase A [Camellia sinensis] 97 6e-18 ref|XP_008378424.1| PREDICTED: respiratory burst oxidase homolog... 97 6e-18 ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog... 97 7e-18 ref|XP_003602726.1| respiratory burst oxidase-like protein D [Me... 97 7e-18 ref|XP_011082784.1| PREDICTED: respiratory burst oxidase homolog... 97 9e-18 ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog... 97 9e-18 ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citr... 97 9e-18 ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog... 96 2e-17 ref|XP_010112007.1| Respiratory burst oxidase-like protein D [Mo... 96 2e-17 ref|XP_012090542.1| PREDICTED: respiratory burst oxidase homolog... 96 2e-17 ref|XP_009792218.1| PREDICTED: respiratory burst oxidase homolog... 95 3e-17 >ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Nelumbo nucifera] Length = 924 Score = 98.2 bits (243), Expect = 3e-18 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 604 RSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 652 >ref|XP_009359839.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus x bretschneideri] Length = 964 Score = 98.2 bits (243), Expect = 3e-18 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 633 RSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 681 >ref|XP_008369593.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus domestica] Length = 965 Score = 98.2 bits (243), Expect = 3e-18 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 634 RSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 682 >ref|XP_008222292.1| PREDICTED: respiratory burst oxidase homolog protein D [Prunus mume] Length = 971 Score = 98.2 bits (243), Expect = 3e-18 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 637 RSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 685 >gb|AGI65628.1| NADPH oxidase, partial [Fragaria x ananassa] Length = 817 Score = 98.2 bits (243), Expect = 3e-18 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 545 RSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 593 >ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog protein D [Fragaria vesca subsp. vesca] Length = 935 Score = 98.2 bits (243), Expect = 3e-18 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 600 RSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 648 >ref|XP_007225362.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica] gi|462422298|gb|EMJ26561.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica] Length = 971 Score = 98.2 bits (243), Expect = 3e-18 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 637 RSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 685 >gb|AKS03954.1| respiratory burst oxidase-like protein 1 [Rubia cordifolia] Length = 927 Score = 97.8 bits (242), Expect = 4e-18 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 593 RSSIKPVNILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 641 >ref|XP_009353482.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus x bretschneideri] Length = 962 Score = 97.4 bits (241), Expect = 6e-18 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV +KVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 631 RSSIKPVKIMKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 679 >gb|AII25876.1| NADPH oxidase A [Camellia sinensis] Length = 922 Score = 97.4 bits (241), Expect = 6e-18 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLA+HMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 604 RSSIKPVKILKVAVYPGNVLAIHMSKPQGFKYKSGQYMFVNCAAVSPFE 652 >ref|XP_008378424.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus domestica] Length = 962 Score = 97.4 bits (241), Expect = 6e-18 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV +KVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 631 RSSIKPVKIIKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 679 >ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog protein C [Nelumbo nucifera] Length = 926 Score = 97.1 bits (240), Expect = 7e-18 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMS+PQGFKYKSGQYMFVNCAAVSPFE Sbjct: 608 RSSIKPVKILKVAVYPGNVLALHMSRPQGFKYKSGQYMFVNCAAVSPFE 656 >ref|XP_003602726.1| respiratory burst oxidase-like protein D [Medicago truncatula] gi|355491774|gb|AES72977.1| respiratory burst oxidase-like protein D [Medicago truncatula] Length = 923 Score = 97.1 bits (240), Expect = 7e-18 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGF+YKSGQYMFVNCAAVSPFE Sbjct: 597 RSSIKPVRILKVAVYPGNVLALHMSKPQGFRYKSGQYMFVNCAAVSPFE 645 >ref|XP_011082784.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Sesamum indicum] Length = 921 Score = 96.7 bits (239), Expect = 9e-18 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHMSKPQGFKYKSGQY+FVNCAAVSPFE Sbjct: 590 RSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYIFVNCAAVSPFE 638 >ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Citrus sinensis] Length = 915 Score = 96.7 bits (239), Expect = 9e-18 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSI+PV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 603 RSSIEPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 651 >ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citrus clementina] gi|557525818|gb|ESR37124.1| hypothetical protein CICLE_v10027774mg [Citrus clementina] gi|641825883|gb|KDO45136.1| hypothetical protein CISIN_1g002525mg [Citrus sinensis] Length = 912 Score = 96.7 bits (239), Expect = 9e-18 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSI+PV LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 600 RSSIEPVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 648 >ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog protein C [Cicer arietinum] Length = 927 Score = 95.9 bits (237), Expect = 2e-17 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVA+YPGNVLALHMSKPQGF+YKSGQYMFVNCAAVSPFE Sbjct: 612 RSSIKPVRILKVALYPGNVLALHMSKPQGFRYKSGQYMFVNCAAVSPFE 660 >ref|XP_010112007.1| Respiratory burst oxidase-like protein D [Morus notabilis] gi|587945987|gb|EXC32352.1| Respiratory burst oxidase-like protein D [Morus notabilis] Length = 924 Score = 95.5 bits (236), Expect = 2e-17 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV LKVAVYPGNVLALHM+KPQGFKYKSGQYMF+NCAAVSPFE Sbjct: 640 RSSIKPVNILKVAVYPGNVLALHMTKPQGFKYKSGQYMFLNCAAVSPFE 688 >ref|XP_012090542.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Jatropha curcas] gi|643706375|gb|KDP22507.1| hypothetical protein JCGZ_26338 [Jatropha curcas] Length = 904 Score = 95.5 bits (236), Expect = 2e-17 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIKPV KVA+YPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 581 RSSIKPVTIKKVAIYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 629 >ref|XP_009792218.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform X3 [Nicotiana sylvestris] Length = 707 Score = 95.1 bits (235), Expect = 3e-17 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = -3 Query: 622 RSSIKPVMTLKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 476 RSSIK V LKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE Sbjct: 572 RSSIKDVKILKVAVYPGNVLALHMSKPQGFKYKSGQYMFVNCAAVSPFE 620