BLASTX nr result
ID: Cornus23_contig00009586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00009586 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275283.1| PREDICTED: gamma-interferon-inducible lysoso... 73 7e-11 emb|CAN76152.1| hypothetical protein VITISV_012674 [Vitis vinifera] 71 4e-10 ref|XP_009417986.1| PREDICTED: gamma-interferon-inducible lysoso... 69 1e-09 ref|XP_010921010.1| PREDICTED: gamma-interferon-inducible lysoso... 67 5e-09 ref|XP_008804105.1| PREDICTED: gamma-interferon-inducible lysoso... 67 7e-09 ref|XP_006847417.1| PREDICTED: gamma-interferon-inducible lysoso... 66 9e-09 ref|XP_009590105.1| PREDICTED: gamma-interferon-inducible lysoso... 66 1e-08 ref|XP_009590102.1| PREDICTED: GILT-like protein F37H8.5 isoform... 66 1e-08 ref|XP_010937930.1| PREDICTED: gamma-interferon-inducible lysoso... 65 2e-08 ref|XP_010937929.1| PREDICTED: gamma-interferon-inducible lysoso... 65 2e-08 gb|ACN40570.1| unknown [Picea sitchensis] 65 2e-08 gb|ABK27097.1| unknown [Picea sitchensis] 65 2e-08 gb|ABK23086.1| unknown [Picea sitchensis] gi|224285577|gb|ACN405... 65 2e-08 gb|ABK21952.1| unknown [Picea sitchensis] 65 2e-08 ref|XP_009760049.1| PREDICTED: gamma-interferon-inducible lysoso... 65 2e-08 ref|XP_009760046.1| PREDICTED: GILT-like protein F37H8.5 isoform... 65 2e-08 gb|KNA10877.1| hypothetical protein SOVF_140330 [Spinacia oleracea] 65 3e-08 gb|KMT05399.1| hypothetical protein BVRB_7g175290 [Beta vulgaris... 65 3e-08 ref|XP_010685916.1| PREDICTED: gamma-interferon-inducible lysoso... 65 3e-08 ref|XP_006847415.1| PREDICTED: gamma-interferon-inducible lysoso... 64 3e-08 >ref|XP_002275283.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X2 [Vitis vinifera] gi|297745847|emb|CBI15903.3| unnamed protein product [Vitis vinifera] Length = 259 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 114 SEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 S+KVSLGLYYE+LCPYSANFIINYLVKIF NGLI IVD Sbjct: 29 SDKVSLGLYYESLCPYSANFIINYLVKIFENGLISIVD 66 >emb|CAN76152.1| hypothetical protein VITISV_012674 [Vitis vinifera] Length = 259 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 114 SEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIV 4 S+KVSLGLYYE+LCPYSANFIINYLVKIF NGLI IV Sbjct: 29 SDKVSLGLYYESLCPYSANFIINYLVKIFENGLISIV 65 >ref|XP_009417986.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Musa acuminata subsp. malaccensis] Length = 249 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 117 SSEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 SS KVSL LYYETLCPYSANFI+NYL KIF +GLI IVD Sbjct: 30 SSPKVSLALYYETLCPYSANFIVNYLAKIFDDGLISIVD 68 >ref|XP_010921010.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Elaeis guineensis] Length = 244 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 117 SSEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 S+ K+ L LYYETLCPY +NFI+NYL KIF NGLIDIVD Sbjct: 24 SARKIPLALYYETLCPYCSNFIVNYLAKIFENGLIDIVD 62 >ref|XP_008804105.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Phoenix dactylifera] Length = 254 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 117 SSEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 S+ KV L LYYETLCPY +NFI+NYL KIF NG+IDIVD Sbjct: 24 SARKVPLALYYETLCPYCSNFIVNYLAKIFENGMIDIVD 62 >ref|XP_006847417.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Amborella trichopoda] gi|548850583|gb|ERN08998.1| hypothetical protein AMTR_s00153p00064140 [Amborella trichopoda] Length = 241 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 114 SEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 +EKVSL LYYETLCPY + F++NYL K+FSNGLIDIVD Sbjct: 25 AEKVSLNLYYETLCPYCSRFVVNYLGKMFSNGLIDIVD 62 >ref|XP_009590105.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform X3 [Nicotiana tomentosiformis] Length = 252 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 111 EKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 EKVSL LYYE+LCPY +NFI+NYL KIF NGLID+VD Sbjct: 29 EKVSLTLYYESLCPYCSNFIVNYLPKIFKNGLIDVVD 65 >ref|XP_009590102.1| PREDICTED: GILT-like protein F37H8.5 isoform X1 [Nicotiana tomentosiformis] Length = 253 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 111 EKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 EKVSL LYYE+LCPY +NFI+NYL KIF NGLID+VD Sbjct: 29 EKVSLTLYYESLCPYCSNFIVNYLPKIFKNGLIDVVD 65 >ref|XP_010937930.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X2 [Elaeis guineensis] Length = 223 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 117 SSEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 S+ KV L LYYETLCPY +NFI+NYL KIF NGLIDI++ Sbjct: 24 SARKVPLALYYETLCPYCSNFIVNYLAKIFENGLIDIIE 62 >ref|XP_010937929.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X1 [Elaeis guineensis] Length = 254 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 117 SSEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 S+ KV L LYYETLCPY +NFI+NYL KIF NGLIDI++ Sbjct: 24 SARKVPLALYYETLCPYCSNFIVNYLAKIFENGLIDIIE 62 >gb|ACN40570.1| unknown [Picea sitchensis] Length = 224 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 114 SEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 +E VS+ LYYE+LCPYSANFI+NYL K+F+NGLIDIVD Sbjct: 16 TETVSVELYYESLCPYSANFIVNYLDKLFTNGLIDIVD 53 >gb|ABK27097.1| unknown [Picea sitchensis] Length = 238 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 114 SEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 +E VS+ LYYE+LCPYSANFI+NYL K+F+NGLIDIVD Sbjct: 32 TETVSVELYYESLCPYSANFIVNYLDKLFTNGLIDIVD 69 >gb|ABK23086.1| unknown [Picea sitchensis] gi|224285577|gb|ACN40507.1| unknown [Picea sitchensis] Length = 240 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 114 SEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 +E VS+ LYYE+LCPYSANFI+NYL K+F+NGLIDIVD Sbjct: 32 TETVSVELYYESLCPYSANFIVNYLDKLFTNGLIDIVD 69 >gb|ABK21952.1| unknown [Picea sitchensis] Length = 240 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 114 SEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 +E VS+ LYYE+LCPYSANFI+NYL K+F+NGLIDIVD Sbjct: 32 TETVSVELYYESLCPYSANFIVNYLDKLFTNGLIDIVD 69 >ref|XP_009760049.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform X3 [Nicotiana sylvestris] Length = 252 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 111 EKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 EKVSL LYYE+LCPY +NFI+NYL K+F NGLID+VD Sbjct: 29 EKVSLVLYYESLCPYCSNFIVNYLPKVFKNGLIDVVD 65 >ref|XP_009760046.1| PREDICTED: GILT-like protein F37H8.5 isoform X1 [Nicotiana sylvestris] Length = 253 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 111 EKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 EKVSL LYYE+LCPY +NFI+NYL K+F NGLID+VD Sbjct: 29 EKVSLVLYYESLCPYCSNFIVNYLPKVFKNGLIDVVD 65 >gb|KNA10877.1| hypothetical protein SOVF_140330 [Spinacia oleracea] Length = 253 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 120 DSSEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 +S+EKVSL LYYE+LCPYSA+FIIN L IF NG+IDIVD Sbjct: 27 NSAEKVSLDLYYESLCPYSADFIINKLAAIFENGIIDIVD 66 >gb|KMT05399.1| hypothetical protein BVRB_7g175290 [Beta vulgaris subsp. vulgaris] Length = 233 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -2 Query: 120 DSSEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 +S +KVSL LYYE+LCPYSANFIIN L IF NG+IDIVD Sbjct: 10 NSPQKVSLDLYYESLCPYSANFIINELTDIFDNGIIDIVD 49 >ref|XP_010685916.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Beta vulgaris subsp. vulgaris] Length = 249 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -2 Query: 120 DSSEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 +S +KVSL LYYE+LCPYSANFIIN L IF NG+IDIVD Sbjct: 26 NSPQKVSLDLYYESLCPYSANFIINELTDIFDNGIIDIVD 65 >ref|XP_006847415.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Amborella trichopoda] gi|548850581|gb|ERN08996.1| hypothetical protein AMTR_s00153p00061670 [Amborella trichopoda] Length = 248 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 114 SEKVSLGLYYETLCPYSANFIINYLVKIFSNGLIDIVD 1 +EKVSL LYYE+LCPYSA F +NYL +FSNGLIDIVD Sbjct: 25 TEKVSLDLYYESLCPYSARFFVNYLDDLFSNGLIDIVD 62