BLASTX nr result
ID: Cornus23_contig00009517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00009517 (301 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ35112.1| putative cyclin-like protein [Erysiphe necator] 87 6e-15 ref|XP_008088051.1| hypothetical protein GLAREA_11717 [Glarea lo... 79 1e-12 gb|EHL01377.1| putative Meiotically up-regulated gene 80 protein... 79 1e-12 emb|CCU75360.1| cyclin-like protein (Clg1) [Blumeria graminis f.... 76 1e-11 gb|EPQ64613.1| Cyclin-like protein [Blumeria graminis f. sp. tri... 76 1e-11 gb|KIN01825.1| hypothetical protein OIDMADRAFT_121918 [Oidiodend... 75 3e-11 ref|XP_007297378.1| meiotically up-regulated 80 protein [Marsson... 75 3e-11 ref|XP_003437311.1| unnamed protein product [Podospora anserina ... 72 1e-10 ref|XP_001548333.1| hypothetical protein BC1G_12902 [Botrytis ci... 71 3e-10 gb|KOM19790.1| hypothetical protein XA68_3615 [Ophiocordyceps un... 71 4e-10 ref|XP_006693932.1| cyclin-like protein [Chaetomium thermophilum... 70 5e-10 gb|KOP45741.1| Meiotically up-regulated gene 80 protein [Madurel... 70 6e-10 ref|XP_003660292.1| hypothetical protein MYCTH_105072 [Mycelioph... 70 6e-10 ref|XP_003652951.1| hypothetical protein THITE_2114823 [Thielavi... 70 6e-10 emb|CCE35247.1| related to cyclin-like protein CLG1 [Claviceps p... 69 1e-09 ref|XP_001596929.1| hypothetical protein SS1G_01121 [Sclerotinia... 69 1e-09 ref|XP_006672227.1| cyclin-like protein (Clg1), putative [Cordyc... 69 1e-09 ref|XP_007810524.1| cyclin-like protein (Clg1), putative [Metarh... 69 1e-09 gb|KKA27606.1| hypothetical protein TD95_001730 [Thielaviopsis p... 69 2e-09 ref|XP_003349935.1| hypothetical protein SMAC_00827 [Sordaria ma... 68 2e-09 >gb|KHJ35112.1| putative cyclin-like protein [Erysiphe necator] Length = 278 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = -1 Query: 181 MIGSGGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPS 17 M+ SGGVCA+LDY++ MT+YVAEMT RLLPTA T+ SLRKFVSGLLSSTRLPS Sbjct: 1 MMSSGGVCAVLDYDLDDMTEYVAEMTQRLLPTANTISSSLRKFVSGLLSSTRLPS 55 >ref|XP_008088051.1| hypothetical protein GLAREA_11717 [Glarea lozoyensis ATCC 20868] gi|512196299|gb|EPE25136.1| hypothetical protein GLAREA_11717 [Glarea lozoyensis ATCC 20868] Length = 327 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDYE+ MTDYVAEMT RL A V P RKFVSGLLSSTRLPST Sbjct: 4 GGVCAVLDYEVPQMTDYVAEMTQRLCNAAVPVSPDFRKFVSGLLSSTRLPST 55 >gb|EHL01377.1| putative Meiotically up-regulated gene 80 protein [Glarea lozoyensis 74030] Length = 306 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDYE+ MTDYVAEMT RL A V P RKFVSGLLSSTRLPST Sbjct: 4 GGVCAVLDYEVPQMTDYVAEMTQRLCNAAVPVSPDFRKFVSGLLSSTRLPST 55 >emb|CCU75360.1| cyclin-like protein (Clg1) [Blumeria graminis f. sp. hordei DH14] Length = 346 Score = 75.9 bits (185), Expect = 1e-11 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = -1 Query: 181 MIGSGGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 MI SGGVCA+LDY+I LMT+YVAEMT RL+ + V SL +FVS LLSSTRLPST Sbjct: 1 MIASGGVCAVLDYDIDLMTEYVAEMTQRLILPSPKVPSSLPEFVSDLLSSTRLPST 56 >gb|EPQ64613.1| Cyclin-like protein [Blumeria graminis f. sp. tritici 96224] Length = 346 Score = 75.9 bits (185), Expect = 1e-11 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = -1 Query: 181 MIGSGGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 MI SGGVCA+LDY+I LMT+YVAEMT RL+ + V SL +FVS LLSSTRLPST Sbjct: 1 MIASGGVCAVLDYDIDLMTEYVAEMTQRLILPSPKVPSSLPEFVSDLLSSTRLPST 56 >gb|KIN01825.1| hypothetical protein OIDMADRAFT_121918 [Oidiodendron maius Zn] Length = 330 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDYE+ MTDYV+EM RL+ + V P+ RKFVSGLLSSTRLP+T Sbjct: 4 GGVCAVLDYEVDQMTDYVSEMAQRLIIPGSPVSPAFRKFVSGLLSSTRLPTT 55 >ref|XP_007297378.1| meiotically up-regulated 80 protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859246|gb|EKD12314.1| meiotically up-regulated 80 protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 343 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -1 Query: 181 MIGSGGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 M+ SGGVCA+LDYEI MT+Y+AEM R++ V PS RKFV GLL+STRLPST Sbjct: 1 MMTSGGVCAVLDYEIDQMTEYIAEMAQRIVLPNAMVTPSFRKFVQGLLTSTRLPST 56 >ref|XP_003437311.1| unnamed protein product [Podospora anserina S mat+] gi|170940169|emb|CAP65396.1| unnamed protein product [Podospora anserina S mat+] gi|681101859|emb|CDP31391.1| Putative Cyclin [Podospora anserina S mat+] Length = 340 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDY+++LM DYV+EM R++ TV P+ RK+VSG+LSSTRLP T Sbjct: 3 GGVCAVLDYDVELMADYVSEMATRVVMPRNTVNPAFRKYVSGILSSTRLPRT 54 >ref|XP_001548333.1| hypothetical protein BC1G_12902 [Botrytis cinerea B05.10] gi|347835766|emb|CCD50338.1| hypothetical protein BofuT4P143000016001 [Botrytis cinerea T4] gi|472237195|gb|EMR82104.1| putative meiotically up-regulated 80 protein [Botrytis cinerea BcDW1] Length = 335 Score = 71.2 bits (173), Expect = 3e-10 Identities = 37/53 (69%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLL-PTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA L+Y+I+ MTDYVAEMT RL+ P T+V P RKFV GLLSSTRLP T Sbjct: 4 GGVCAHLEYQIEDMTDYVAEMTQRLVDPNTTSVAPEFRKFVLGLLSSTRLPHT 56 >gb|KOM19790.1| hypothetical protein XA68_3615 [Ophiocordyceps unilateralis] Length = 455 Score = 70.9 bits (172), Expect = 4e-10 Identities = 41/79 (51%), Positives = 55/79 (69%), Gaps = 3/79 (3%) Frame = -1 Query: 241 SFTPVERRTS--QSVVSDKSFVMIGSGGVCAILDYEIQLMTDYVAEMTLRLL-PTATTVM 71 S TP +R++ + + S S + +GGVCA+LDYE+ +M DYVAEM R++ P ATT Sbjct: 101 SLTPPRQRSTGLRRITSPHSSAKM-TGGVCAVLDYEVNMMADYVAEMATRIVTPEATTTT 159 Query: 70 PSLRKFVSGLLSSTRLPST 14 P RKFVS +L+STRLPST Sbjct: 160 P-FRKFVSQILTSTRLPST 177 >ref|XP_006693932.1| cyclin-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340960455|gb|EGS21636.1| cyclin-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 327 Score = 70.5 bits (171), Expect = 5e-10 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLL-PTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDY+++LM DYVAEM RL+ P TV P+ RKFV +L+STRLPST Sbjct: 3 GGVCAVLDYDVELMADYVAEMATRLVTPHTNTVNPAFRKFVCQILTSTRLPST 55 >gb|KOP45741.1| Meiotically up-regulated gene 80 protein [Madurella mycetomatis] Length = 342 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDY+++LM DYV+EM R++ V P+ RKFVS +LSSTRLPST Sbjct: 3 GGVCAVLDYDVELMADYVSEMATRVVMPQRAVNPAFRKFVSQILSSTRLPST 54 >ref|XP_003660292.1| hypothetical protein MYCTH_105072 [Myceliophthora thermophila ATCC 42464] gi|347007559|gb|AEO55047.1| hypothetical protein MYCTH_105072 [Myceliophthora thermophila ATCC 42464] Length = 346 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDYE++LM DYV+EM R++ V P+ RKFVS +L+STRLPST Sbjct: 3 GGVCAVLDYEVELMADYVSEMATRIVMPQRQVNPAFRKFVSQILTSTRLPST 54 >ref|XP_003652951.1| hypothetical protein THITE_2114823 [Thielavia terrestris NRRL 8126] gi|347000213|gb|AEO66615.1| hypothetical protein THITE_2114823 [Thielavia terrestris NRRL 8126] Length = 345 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDYE++LM DYV+EM R++ V P+ RKFVS +L+STRLPST Sbjct: 3 GGVCAVLDYEVELMADYVSEMATRIVMPERQVNPAFRKFVSQILTSTRLPST 54 >emb|CCE35247.1| related to cyclin-like protein CLG1 [Claviceps purpurea 20.1] Length = 340 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDY+I LM DYVAEM +R++ V P+ RKFV+ +L+STRLPST Sbjct: 3 GGVCAVLDYDIDLMADYVAEMAVRVVTPDGAVTPAFRKFVAQILTSTRLPST 54 >ref|XP_001596929.1| hypothetical protein SS1G_01121 [Sclerotinia sclerotiorum 1980] gi|154696459|gb|EDN96197.1| hypothetical protein SS1G_01121 [Sclerotinia sclerotiorum 1980 UF-70] Length = 332 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA L+Y+I+ MTDYVA+M RL+ T+V P RKFV GLLSSTRLP T Sbjct: 4 GGVCAHLEYQIEDMTDYVADMAQRLVDPTTSVSPEFRKFVLGLLSSTRLPHT 55 >ref|XP_006672227.1| cyclin-like protein (Clg1), putative [Cordyceps militaris CM01] gi|346321006|gb|EGX90606.1| cyclin-like protein (Clg1), putative [Cordyceps militaris CM01] Length = 330 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDYE+ LMT+Y+AEM RL+ +T+ RKFV +L+STRLPST Sbjct: 3 GGVCAVLDYEVDLMTEYIAEMATRLVTPGSTLSSPFRKFVKQILTSTRLPST 54 >ref|XP_007810524.1| cyclin-like protein (Clg1), putative [Metarhizium acridum CQMa 102] gi|322697978|gb|EFY89752.1| cyclin-like protein (Clg1), putative [Metarhizium acridum CQMa 102] Length = 332 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDYE+ +M +YV+EM +R++ TV P RKFV+ +L+STRLPST Sbjct: 3 GGVCAVLDYEVDMMAEYVSEMAVRVVTPDATVTPGFRKFVTQILTSTRLPST 54 >gb|KKA27606.1| hypothetical protein TD95_001730 [Thielaviopsis punctulata] Length = 360 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDYE++ MTDYVAEM +R++ + V RKFVS +L+STRLPST Sbjct: 3 GGVCAVLDYEVEHMTDYVAEMAVRVVMPESAVSDRFRKFVSQILTSTRLPST 54 >ref|XP_003349935.1| hypothetical protein SMAC_00827 [Sordaria macrospora k-hell] gi|380095324|emb|CCC06797.1| unnamed protein product [Sordaria macrospora k-hell] Length = 339 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -1 Query: 169 GGVCAILDYEIQLMTDYVAEMTLRLLPTATTVMPSLRKFVSGLLSSTRLPST 14 GGVCA+LDYE++LM DYV+EM R++ + V + RKFVS +L+STRLPST Sbjct: 3 GGVCAVLDYEVELMADYVSEMATRIVMPQSAVNTAFRKFVSQILTSTRLPST 54