BLASTX nr result
ID: Cornus23_contig00009071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00009071 (406 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007405671.1| hypothetical protein MELLADRAFT_92514 [Melam... 79 1e-12 ref|XP_007413090.1| hypothetical protein MELLADRAFT_90070 [Melam... 79 1e-12 ref|XP_007417422.1| hypothetical protein MELLADRAFT_94716 [Melam... 79 1e-12 ref|XP_007411822.1| hypothetical protein MELLADRAFT_88315 [Melam... 79 1e-12 ref|XP_007413092.1| hypothetical protein MELLADRAFT_90079 [Melam... 79 1e-12 ref|XP_014564976.1| hypothetical protein L969DRAFT_55155 [Mixia ... 67 5e-09 ref|XP_001895031.1| hypothetical protein Bm1_17870 [Brugia malayi] 64 6e-08 ref|XP_007413087.1| hypothetical protein MELLADRAFT_90066 [Melam... 62 2e-07 ref|XP_007413083.1| hypothetical protein MELLADRAFT_90060 [Melam... 62 2e-07 ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melam... 62 2e-07 ref|XP_007415545.1| hypothetical protein MELLADRAFT_92715 [Melam... 62 2e-07 ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melam... 62 2e-07 ref|XP_007417423.1| hypothetical protein MELLADRAFT_94720 [Melam... 62 2e-07 ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melam... 62 2e-07 ref|XP_007417435.1| hypothetical protein MELLADRAFT_94733 [Melam... 62 2e-07 ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melam... 62 2e-07 ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melam... 62 2e-07 ref|XP_007418686.1| hypothetical protein MELLADRAFT_96218 [Melam... 62 2e-07 gb|EJY65599.1| hypothetical protein OXYTRI_14247 [Oxytricha trif... 60 8e-07 ref|XP_009044647.1| hypothetical protein LOTGIDRAFT_202939 [Lott... 57 5e-06 >ref|XP_007405671.1| hypothetical protein MELLADRAFT_92514 [Melampsora larici-populina 98AG31] gi|328861967|gb|EGG11069.1| hypothetical protein MELLADRAFT_92514 [Melampsora larici-populina 98AG31] Length = 126 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 2 CAPAAFHRSGGYFSGPLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 CAPAA R G FSGPLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 80 CAPAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 125 >ref|XP_007413090.1| hypothetical protein MELLADRAFT_90070 [Melampsora larici-populina 98AG31] gi|328854511|gb|EGG03643.1| hypothetical protein MELLADRAFT_90070 [Melampsora larici-populina 98AG31] Length = 379 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 2 CAPAAFHRSGGYFSGPLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 CAPAA R G FSGPLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 333 CAPAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 378 >ref|XP_007417422.1| hypothetical protein MELLADRAFT_94716 [Melampsora larici-populina 98AG31] gi|328850159|gb|EGF99328.1| hypothetical protein MELLADRAFT_94716 [Melampsora larici-populina 98AG31] Length = 361 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 2 CAPAAFHRSGGYFSGPLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 CAPAA R G FSGPLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 315 CAPAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 360 >ref|XP_007411822.1| hypothetical protein MELLADRAFT_88315 [Melampsora larici-populina 98AG31] gi|599424960|ref|XP_007417440.1| hypothetical protein MELLADRAFT_94739 [Melampsora larici-populina 98AG31] gi|328850145|gb|EGF99314.1| hypothetical protein MELLADRAFT_94739 [Melampsora larici-populina 98AG31] gi|328855945|gb|EGG05069.1| hypothetical protein MELLADRAFT_88315 [Melampsora larici-populina 98AG31] Length = 113 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 2 CAPAAFHRSGGYFSGPLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 CAPAA R G FSGPLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 67 CAPAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 112 >ref|XP_007413092.1| hypothetical protein MELLADRAFT_90079 [Melampsora larici-populina 98AG31] gi|599427384|ref|XP_007418191.1| hypothetical protein MELLADRAFT_95625 [Melampsora larici-populina 98AG31] gi|328849357|gb|EGF98539.1| hypothetical protein MELLADRAFT_95625 [Melampsora larici-populina 98AG31] gi|328854513|gb|EGG03645.1| hypothetical protein MELLADRAFT_90079 [Melampsora larici-populina 98AG31] Length = 88 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 2 CAPAAFHRSGGYFSGPLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 CAPAA R G FSGPLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 42 CAPAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 87 >ref|XP_014564976.1| hypothetical protein L969DRAFT_55155 [Mixia osmundae IAM 14324] gi|953445631|ref|XP_014566368.1| hypothetical protein L969DRAFT_52825 [Mixia osmundae IAM 14324] gi|953449717|ref|XP_014568411.1| hypothetical protein L969DRAFT_47457 [Mixia osmundae IAM 14324] gi|953450651|ref|XP_014568878.1| hypothetical protein L969DRAFT_48272 [Mixia osmundae IAM 14324] gi|358057767|dbj|GAA96378.1| hypothetical protein E5Q_03044 [Mixia osmundae IAM 14324] gi|658161698|gb|KEI36421.1| hypothetical protein L969DRAFT_55155 [Mixia osmundae IAM 14324] gi|658163096|gb|KEI37813.1| hypothetical protein L969DRAFT_52825 [Mixia osmundae IAM 14324] gi|658165072|gb|KEI39784.1| hypothetical protein L969DRAFT_47457 [Mixia osmundae IAM 14324] gi|658165590|gb|KEI40302.1| hypothetical protein L969DRAFT_48272 [Mixia osmundae IAM 14324] Length = 308 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 2 CAPAAFHRSGGYFSGPLSGIEPLFPVTRHYHGKPLNYHQK 121 CAPAA RS G FSGPLSG +PLFPVTR +HGKPL YH+K Sbjct: 212 CAPAALLRSEGRFSGPLSGTKPLFPVTRRHHGKPLPYHRK 251 >ref|XP_001895031.1| hypothetical protein Bm1_17870 [Brugia malayi] Length = 62 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +2 Query: 2 CAPAAFHRSGGYFSGPLSGIEPLFPVTRHYHGKPLNYHQKLIGQ 133 CAPAAF G FSG LSG+EPLF VTR+ HG+ +NYH+KLI Q Sbjct: 4 CAPAAFLGCGSRFSGSLSGVEPLFSVTRYNHGRHINYHRKLIRQ 47 >ref|XP_007413087.1| hypothetical protein MELLADRAFT_90066 [Melampsora larici-populina 98AG31] gi|328854508|gb|EGG03640.1| hypothetical protein MELLADRAFT_90066 [Melampsora larici-populina 98AG31] Length = 76 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 45 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 75 >ref|XP_007413083.1| hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] gi|328854504|gb|EGG03636.1| hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] Length = 87 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 56 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 86 >ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] gi|328853743|gb|EGG02880.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] Length = 134 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 103 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 133 >ref|XP_007415545.1| hypothetical protein MELLADRAFT_92715 [Melampsora larici-populina 98AG31] gi|328852046|gb|EGG01195.1| hypothetical protein MELLADRAFT_92715 [Melampsora larici-populina 98AG31] Length = 63 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 32 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 62 >ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] gi|328852044|gb|EGG01193.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] Length = 130 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 99 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 129 >ref|XP_007417423.1| hypothetical protein MELLADRAFT_94720 [Melampsora larici-populina 98AG31] gi|328850158|gb|EGF99327.1| hypothetical protein MELLADRAFT_94720 [Melampsora larici-populina 98AG31] Length = 304 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 273 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 303 >ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] gi|328850152|gb|EGF99321.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] Length = 113 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 82 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 112 >ref|XP_007417435.1| hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] gi|328850149|gb|EGF99318.1| hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] Length = 106 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 75 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 105 >ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] gi|599406978|ref|XP_007413435.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|599420165|ref|XP_007416289.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|599426092|ref|XP_007417784.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328849783|gb|EGF98957.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328851287|gb|EGG00443.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|328854166|gb|EGG03300.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|328861970|gb|EGG11072.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] Length = 103 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 72 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 102 >ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] gi|328848488|gb|EGF97701.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] Length = 146 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 115 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 145 >ref|XP_007418686.1| hypothetical protein MELLADRAFT_96218 [Melampsora larici-populina 98AG31] gi|599431606|ref|XP_007419490.1| hypothetical protein MELLADRAFT_86345 [Melampsora larici-populina 98AG31] gi|328847956|gb|EGF97239.1| hypothetical protein MELLADRAFT_86345 [Melampsora larici-populina 98AG31] gi|328848852|gb|EGF98047.1| hypothetical protein MELLADRAFT_96218 [Melampsora larici-populina 98AG31] Length = 78 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 47 PLSGIEPLFPVTRHYHGKPLNYHQKLIGQGF 139 PLSGIEPLFPVTRH+HG+PL+YH+KLIGQ F Sbjct: 47 PLSGIEPLFPVTRHHHGRPLSYHRKLIGQIF 77 >gb|EJY65599.1| hypothetical protein OXYTRI_14247 [Oxytricha trifallax] Length = 164 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +2 Query: 5 APAAFHRSGGYFSGPLSGIEPLFPVTRHYHGKPLNYHQKLIGQ 133 APAAF R G FSG LSGIEP VTR HG P++YH+KL+GQ Sbjct: 119 APAAFLRCGSRFSGSLSGIEPQSSVTRERHGSPIHYHRKLMGQ 161 >ref|XP_009044647.1| hypothetical protein LOTGIDRAFT_202939 [Lottia gigantea] gi|556116014|gb|ESP04666.1| hypothetical protein LOTGIDRAFT_202939 [Lottia gigantea] Length = 60 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = -1 Query: 139 KTLPYQLLMVI*RLTMVMTGNGE*GFDSGEGA*EIATTSMEGSRRA 2 K L +QL MV T V+TGNGE GFDSGEGA E ATTS EGSRRA Sbjct: 2 KCLSHQLAMVGDLPTTVLTGNGESGFDSGEGACETATTSKEGSRRA 47