BLASTX nr result
ID: Cornus23_contig00008346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00008346 (706 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010104528.1| putative cytochrome c [Morus notabilis] gi|5... 122 3e-25 sp|P00059.1|CYC_ABUTH RecName: Full=Cytochrome c 121 5e-25 ref|XP_008219111.1| PREDICTED: cytochrome c isoform X1 [Prunus m... 120 6e-25 sp|P00062.1|CYC_SAMNI RecName: Full=Cytochrome c 120 6e-25 ref|XP_006441651.1| hypothetical protein CICLE_v10022949mg [Citr... 120 6e-25 ref|XP_007225902.1| hypothetical protein PRUPE_ppa013626mg [Prun... 120 6e-25 ref|XP_007019872.1| Cytochrome c-2 [Theobroma cacao] gi|50872520... 120 8e-25 ref|XP_009777286.1| PREDICTED: cytochrome c [Nicotiana sylvestris] 119 2e-24 ref|XP_010062395.1| PREDICTED: cytochrome c [Eucalyptus grandis]... 119 2e-24 sp|P00064.1|CYC_ALLPO RecName: Full=Cytochrome c 119 2e-24 gb|AFK41027.1| unknown [Lotus japonicus] gi|388512169|gb|AFK4414... 119 2e-24 ref|XP_003610916.1| cytochrome protein C [Medicago truncatula] g... 119 2e-24 sp|P00058.1|CYC_GOSBA RecName: Full=Cytochrome c 119 2e-24 sp|P00060.2|CYC_SOLLC RecName: Full=Cytochrome c 119 2e-24 ref|XP_012480640.1| PREDICTED: cytochrome c [Gossypium raimondii... 119 2e-24 gb|KHF99556.1| Cytochrome c [Gossypium arboreum] 119 2e-24 ref|XP_012446433.1| PREDICTED: cytochrome c [Gossypium raimondii... 118 3e-24 gb|KHG02016.1| Cytochrome c [Gossypium arboreum] 118 3e-24 ref|XP_010437668.1| PREDICTED: probable cytochrome c At4g10040 [... 118 3e-24 ref|XP_009357217.1| PREDICTED: cytochrome c [Pyrus x bretschneid... 118 3e-24 >ref|XP_010104528.1| putative cytochrome c [Morus notabilis] gi|587913312|gb|EXC01129.1| putative cytochrome c [Morus notabilis] Length = 113 Score = 122 bits (305), Expect = 3e-25 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLKESTA Sbjct: 54 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 112 >sp|P00059.1|CYC_ABUTH RecName: Full=Cytochrome c Length = 111 Score = 121 bits (303), Expect = 5e-25 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNW ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLK+STA Sbjct: 53 GYSYSAANKNMAVNWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZSTA 111 >ref|XP_008219111.1| PREDICTED: cytochrome c isoform X1 [Prunus mume] Length = 112 Score = 120 bits (302), Expect = 6e-25 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLK+STA Sbjct: 54 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 112 >sp|P00062.1|CYC_SAMNI RecName: Full=Cytochrome c Length = 111 Score = 120 bits (302), Expect = 6e-25 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLK+STA Sbjct: 53 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 111 >ref|XP_006441651.1| hypothetical protein CICLE_v10022949mg [Citrus clementina] gi|568849278|ref|XP_006478387.1| PREDICTED: probable cytochrome c At4g10040-like [Citrus sinensis] gi|557543913|gb|ESR54891.1| hypothetical protein CICLE_v10022949mg [Citrus clementina] gi|641832717|gb|KDO51745.1| hypothetical protein CISIN_1g033761mg [Citrus sinensis] Length = 112 Score = 120 bits (302), Expect = 6e-25 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLK+STA Sbjct: 54 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 112 >ref|XP_007225902.1| hypothetical protein PRUPE_ppa013626mg [Prunus persica] gi|462422838|gb|EMJ27101.1| hypothetical protein PRUPE_ppa013626mg [Prunus persica] Length = 112 Score = 120 bits (302), Expect = 6e-25 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLK+STA Sbjct: 54 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 112 >ref|XP_007019872.1| Cytochrome c-2 [Theobroma cacao] gi|508725200|gb|EOY17097.1| Cytochrome c-2 [Theobroma cacao] Length = 113 Score = 120 bits (301), Expect = 8e-25 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQ+RADLI+YLKESTA Sbjct: 54 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTA 112 >ref|XP_009777286.1| PREDICTED: cytochrome c [Nicotiana sylvestris] Length = 112 Score = 119 bits (298), Expect = 2e-24 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAV WEENTLYDYLLNPKKYIPGTKMVFPGLKKPQ+RADLI+YLKE+TA Sbjct: 54 GYSYSAANKNMAVTWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEATA 112 >ref|XP_010062395.1| PREDICTED: cytochrome c [Eucalyptus grandis] gi|629104073|gb|KCW69542.1| hypothetical protein EUGRSUZ_F02978 [Eucalyptus grandis] Length = 113 Score = 119 bits (298), Expect = 2e-24 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI++LK+STA Sbjct: 54 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAFLKQSTA 112 >sp|P00064.1|CYC_ALLPO RecName: Full=Cytochrome c Length = 111 Score = 119 bits (298), Expect = 2e-24 Identities = 54/59 (91%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAV W+++TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLKESTA Sbjct: 53 GYSYSAANKNMAVVWZZBTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 111 >gb|AFK41027.1| unknown [Lotus japonicus] gi|388512169|gb|AFK44146.1| unknown [Lotus japonicus] Length = 113 Score = 119 bits (298), Expect = 2e-24 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQ+RADLI+YLKE+TA Sbjct: 54 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEATA 112 >ref|XP_003610916.1| cytochrome protein C [Medicago truncatula] gi|355512251|gb|AES93874.1| cytochrome protein C [Medicago truncatula] Length = 113 Score = 119 bits (298), Expect = 2e-24 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQ+RADLI+YLKE+TA Sbjct: 54 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEATA 112 >sp|P00058.1|CYC_GOSBA RecName: Full=Cytochrome c Length = 111 Score = 119 bits (297), Expect = 2e-24 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAV W ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLK+STA Sbjct: 53 GYSYSAANKNMAVQWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZSTA 111 >sp|P00060.2|CYC_SOLLC RecName: Full=Cytochrome c Length = 111 Score = 119 bits (297), Expect = 2e-24 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAVNW ENTLYDYLLNPKKYIPGTKMVFPGLKKPQ+RADLI+YLKE+TA Sbjct: 53 GYSYSAANKNMAVNWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEATA 111 >ref|XP_012480640.1| PREDICTED: cytochrome c [Gossypium raimondii] gi|763765624|gb|KJB32878.1| hypothetical protein B456_005G266300 [Gossypium raimondii] Length = 112 Score = 119 bits (297), Expect = 2e-24 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAV W ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLKESTA Sbjct: 54 GYSYSAANKNMAVVWSENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 112 >gb|KHF99556.1| Cytochrome c [Gossypium arboreum] Length = 112 Score = 119 bits (297), Expect = 2e-24 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAV W ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLKESTA Sbjct: 54 GYSYSAANKNMAVIWSENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 112 >ref|XP_012446433.1| PREDICTED: cytochrome c [Gossypium raimondii] gi|763792673|gb|KJB59669.1| hypothetical protein B456_009G266800 [Gossypium raimondii] Length = 113 Score = 118 bits (296), Expect = 3e-24 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAV WEE TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLKESTA Sbjct: 54 GYSYSAANKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 112 >gb|KHG02016.1| Cytochrome c [Gossypium arboreum] Length = 113 Score = 118 bits (296), Expect = 3e-24 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKNMAV WEE TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLKESTA Sbjct: 54 GYSYSAANKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 112 >ref|XP_010437668.1| PREDICTED: probable cytochrome c At4g10040 [Camelina sativa] gi|727491754|ref|XP_010421920.1| PREDICTED: probable cytochrome c At4g10040 [Camelina sativa] gi|727566062|ref|XP_010455399.1| PREDICTED: probable cytochrome c At4g10040 [Camelina sativa] Length = 112 Score = 118 bits (296), Expect = 3e-24 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANK+MAVNWEE TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLKE TA Sbjct: 54 GYSYSAANKSMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGTA 112 >ref|XP_009357217.1| PREDICTED: cytochrome c [Pyrus x bretschneideri] Length = 112 Score = 118 bits (296), Expect = 3e-24 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -3 Query: 704 GYSYSAANKNMAVNWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 528 GYSYSAANKN AV WEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLK+STA Sbjct: 54 GYSYSAANKNKAVTWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 112