BLASTX nr result
ID: Cornus23_contig00008233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00008233 (490 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK35471.1| unknown [Lotus japonicus] 62 7e-09 gb|KMZ72544.1| putative Mitosis protein dim1 [Zostera marina] 62 9e-09 gb|KMZ72541.1| putative Mitosis protein dim1 [Zostera marina] 62 9e-09 emb|CDP12287.1| unnamed protein product [Coffea canephora] gi|66... 62 9e-09 emb|CDP19065.1| unnamed protein product [Coffea canephora] 62 9e-09 gb|EMT17006.1| Thioredoxin-like protein 4A [Aegilops tauschii] 62 1e-08 gb|EMT25324.1| Thioredoxin-like protein 4A [Aegilops tauschii] 62 1e-08 gb|EMT05356.1| Thioredoxin-like protein 4A [Aegilops tauschii] 62 1e-08 gb|ACJ85953.1| unknown [Medicago truncatula] gi|388522237|gb|AFK... 62 1e-08 gb|EMS68243.1| Thioredoxin-like protein 4A [Triticum urartu] 62 1e-08 ref|XP_003568138.1| PREDICTED: thioredoxin-like protein YLS8 [Br... 62 1e-08 dbj|BAJ88120.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 1e-08 dbj|BAJ90457.1| predicted protein [Hordeum vulgare subsp. vulgar... 62 1e-08 dbj|BAJ90446.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 1e-08 ref|XP_003590204.1| mRNA splicing factor, thioredoxin-like U5 sn... 62 1e-08 ref|XP_003603529.1| mRNA splicing factor, thioredoxin-like U5 sn... 62 1e-08 gb|ALC79352.1| hypothetical protein, partial [Triticum monococcu... 62 1e-08 gb|AEW07526.1| hypothetical protein 0_3988_01, partial [Pinus ra... 62 1e-08 ref|XP_009386081.1| PREDICTED: thioredoxin-like protein YLS8 [Mu... 61 2e-08 gb|KCW65068.1| hypothetical protein EUGRSUZ_G02580 [Eucalyptus g... 61 2e-08 >gb|AFK35471.1| unknown [Lotus japonicus] Length = 142 Score = 62.4 bits (150), Expect(2) = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEFIDIVETIYRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 7e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >gb|KMZ72544.1| putative Mitosis protein dim1 [Zostera marina] Length = 142 Score = 62.0 bits (149), Expect(2) = 9e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEFIDIVET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFIDIVETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 9e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >gb|KMZ72541.1| putative Mitosis protein dim1 [Zostera marina] Length = 142 Score = 62.0 bits (149), Expect(2) = 9e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEFIDIVET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFIDIVETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 9e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >emb|CDP12287.1| unnamed protein product [Coffea canephora] gi|661888714|emb|CDP07750.1| unnamed protein product [Coffea canephora] Length = 142 Score = 62.0 bits (149), Expect(2) = 9e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEFIDIVET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFIDIVETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 9e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >emb|CDP19065.1| unnamed protein product [Coffea canephora] Length = 142 Score = 62.0 bits (149), Expect(2) = 9e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEFIDIVET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFIDIVETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 9e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >gb|EMT17006.1| Thioredoxin-like protein 4A [Aegilops tauschii] Length = 241 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEF+DIVET+YRGARKGRGLVIAPK Sbjct: 204 AMKDKQEFVDIVETVYRGARKGRGLVIAPK 233 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 233 KDYSTKYRY 241 >gb|EMT25324.1| Thioredoxin-like protein 4A [Aegilops tauschii] Length = 163 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEF+DIVET+YRGARKGRGLVIAPK Sbjct: 126 AMKDKQEFVDIVETVYRGARKGRGLVIAPK 155 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 155 KDYSTKYRY 163 >gb|EMT05356.1| Thioredoxin-like protein 4A [Aegilops tauschii] Length = 150 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEF+DIVET+YRGARKGRGLVIAPK Sbjct: 65 AMKDKQEFVDIVETVYRGARKGRGLVIAPK 94 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 94 KDYSTKYRY 102 >gb|ACJ85953.1| unknown [Medicago truncatula] gi|388522237|gb|AFK49180.1| unknown [Medicago truncatula] Length = 142 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEFIDI+ET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFIDIIETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >gb|EMS68243.1| Thioredoxin-like protein 4A [Triticum urartu] Length = 142 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEF+DIVET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFVDIVETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >ref|XP_003568138.1| PREDICTED: thioredoxin-like protein YLS8 [Brachypodium distachyon] gi|944069991|gb|KQK05475.1| hypothetical protein BRADI_2g20240 [Brachypodium distachyon] Length = 142 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEF+DIVET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFVDIVETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >dbj|BAJ88120.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 142 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEF+DIVET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFVDIVETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >dbj|BAJ90457.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326534264|dbj|BAJ89482.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 142 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEF+DIVET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFVDIVETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >dbj|BAJ90446.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 142 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEF+DIVET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFVDIVETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >ref|XP_003590204.1| mRNA splicing factor, thioredoxin-like U5 snRNP protein [Medicago truncatula] gi|116782603|gb|ABK22569.1| unknown [Picea sitchensis] gi|116782987|gb|ABK22751.1| unknown [Picea sitchensis] gi|355479252|gb|AES60455.1| mRNA splicing factor, thioredoxin-like U5 snRNP protein [Medicago truncatula] Length = 142 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEFIDI+ET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFIDIIETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >ref|XP_003603529.1| mRNA splicing factor, thioredoxin-like U5 snRNP protein [Medicago truncatula] gi|217069812|gb|ACJ83266.1| unknown [Medicago truncatula] gi|355492577|gb|AES73780.1| mRNA splicing factor, thioredoxin-like U5 snRNP protein [Medicago truncatula] gi|388516725|gb|AFK46424.1| unknown [Medicago truncatula] Length = 142 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEFIDI+ET+YRGARKGRGLVIAPK Sbjct: 105 AMKDKQEFIDIIETVYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >gb|ALC79352.1| hypothetical protein, partial [Triticum monococcum subsp. aegilopoides] gi|925175238|gb|ALC79353.1| hypothetical protein, partial [Triticum monococcum] Length = 102 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEF+DIVET+YRGARKGRGLVIAPK Sbjct: 65 AMKDKQEFVDIVETVYRGARKGRGLVIAPK 94 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 94 KDYSTKYRY 102 >gb|AEW07526.1| hypothetical protein 0_3988_01, partial [Pinus radiata] gi|383152149|gb|AFG58136.1| hypothetical protein 0_3988_01, partial [Pinus taeda] gi|383152151|gb|AFG58137.1| hypothetical protein 0_3988_01, partial [Pinus taeda] gi|383152153|gb|AFG58138.1| hypothetical protein 0_3988_01, partial [Pinus taeda] Length = 49 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 AMKDKQEFIDI+ET+YRGARKGRGLVIAPK Sbjct: 12 AMKDKQEFIDIIETVYRGARKGRGLVIAPK 41 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 41 KDYSTKYRY 49 >ref|XP_009386081.1| PREDICTED: thioredoxin-like protein YLS8 [Musa acuminata subsp. malaccensis] Length = 142 Score = 61.2 bits (147), Expect(2) = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 A+KDKQEFIDIVETIYRGARKGRGLVIAPK Sbjct: 105 ALKDKQEFIDIVETIYRGARKGRGLVIAPK 134 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 134 KDYSTKYRY 142 >gb|KCW65068.1| hypothetical protein EUGRSUZ_G02580 [Eucalyptus grandis] Length = 317 Score = 60.8 bits (146), Expect(2) = 2e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AMKDKQEFIDIVETIYRGARKGRGLVIAPK 90 A+KDKQEFIDIVET+YRGARKGRGLVIAPK Sbjct: 280 ALKDKQEFIDIVETVYRGARKGRGLVIAPK 309 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 93 KDYSTKYRY 119 KDYSTKYRY Sbjct: 309 KDYSTKYRY 317