BLASTX nr result
ID: Cornus23_contig00008185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00008185 (2620 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007209065.1| hypothetical protein PRUPE_ppa024801mg, part... 68 4e-08 >ref|XP_007209065.1| hypothetical protein PRUPE_ppa024801mg, partial [Prunus persica] gi|462404800|gb|EMJ10264.1| hypothetical protein PRUPE_ppa024801mg, partial [Prunus persica] Length = 474 Score = 68.2 bits (165), Expect = 4e-08 Identities = 37/86 (43%), Positives = 50/86 (58%) Frame = +1 Query: 1750 EALVSEHSLLSIPYPVSMHQYNQDSIAITHCIKNTPIVINNEKFILPQIFVVSTPSTYDF 1929 E LV E + PV + Q++ + +THCI N P I ++F LP F+ S +Y F Sbjct: 181 EELVPEQFRQKLARPVRIIQFDTRPVYLTHCINNIPTRIERQQFNLPLTFI-SLVGSYSF 239 Query: 1930 ILELSFINSLTGGFLDTPTDLQFF*K 2007 IL L+F+ SL GGFL TP D+ FF K Sbjct: 240 ILGLNFLKSLQGGFLYTPPDITFFKK 265